Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03066
Gene name
Locationscaffold_03:569586..570231
Strand+
Gene length (bp)645
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 1.4E-08 119 200

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Peroxisome Peroxisomal targeting signal 0.5654 0.4586 0.044 0.0153 0.3394 0.0131 0.097 0.1091 0.037 0.8851

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5176
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3545
Ophiocordyceps australis map64 (Brazil) OphauB2|1084
Ophiocordyceps camponoti-floridani Ophcf2|03066 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|533
Ophiocordyceps kimflemingae Ophio5|4
Ophiocordyceps subramaniannii Hirsu2|3847

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03066
MRPPTSPLRIVSPALGLIPSDTPPDLFDSAVAHFSSIAWVAGRLRRPGGILFIPQSFNPLSPRGDQFIGDTLGRN
PRGLRHMLGLFFPADGQLTDGTHPVHRIETFCSVGVGLSGYEDVMHGGMVCSLLDESFGIVHELNTVLGKQPPAG
RNHMTASLSVDFRRPVPVPTDVWVSAWIEGVEDRKAFMRAEMKGADGVVLASARSTWIALKEKL*
Coding >Ophcf2|03066
ATGCGTCCTCCTACCTCCCCGCTTCGCATCGTCTCCCCAGCCCTCGGTCTCATCCCTTCCGATACACCTCCAGAC
CTCTTCGACTCGGCGGTCGCGCACTTCTCGTCCATAGCCTGGGTCGCTGGTCGTCTTCGTCGGCCCGGTGGCATT
CTGTTCATCCCGCAAAGCTTCAACCCCTTGTCGCCGCGCGGAGACCAGTTTATTGGCGACACGCTCGGGAGGAAC
CCCCGCGGTCTACGTCATATGCTCGGCCTCTTCTTCCCAGCTGATGGACAGTTGACCGACGGCACACACCCCGTC
CATCGCATAGAGACGTTCTGCTCCGTGGGTGTCGGACTCTCCGGCTATGAAGACGTCATGCACGGCGGCATGGTC
TGCTCCCTCTTGGACGAAAGCTTCGGAATAGTTCACGAGCTCAACACCGTGCTCGGAAAGCAGCCTCCTGCTGGG
AGGAATCATATGACGGCCAGCCTGAGTGTGGATTTCCGTCGTCCGGTTCCGGTTCCGACTGATGTGTGGGTCTCT
GCTTGGATTGAGGGCGTGGAGGATCGTAAGGCTTTTATGAGGGCTGAGATGAAGGGCGCTGATGGTGTTGTTTTG
GCTTCTGCGCGGAGCACTTGGATTGCCTTGAAAGAAAAGTTGTAG
Transcript >Ophcf2|03066
ATGCGTCCTCCTACCTCCCCGCTTCGCATCGTCTCCCCAGCCCTCGGTCTCATCCCTTCCGATACACCTCCAGAC
CTCTTCGACTCGGCGGTCGCGCACTTCTCGTCCATAGCCTGGGTCGCTGGTCGTCTTCGTCGGCCCGGTGGCATT
CTGTTCATCCCGCAAAGCTTCAACCCCTTGTCGCCGCGCGGAGACCAGTTTATTGGCGACACGCTCGGGAGGAAC
CCCCGCGGTCTACGTCATATGCTCGGCCTCTTCTTCCCAGCTGATGGACAGTTGACCGACGGCACACACCCCGTC
CATCGCATAGAGACGTTCTGCTCCGTGGGTGTCGGACTCTCCGGCTATGAAGACGTCATGCACGGCGGCATGGTC
TGCTCCCTCTTGGACGAAAGCTTCGGAATAGTTCACGAGCTCAACACCGTGCTCGGAAAGCAGCCTCCTGCTGGG
AGGAATCATATGACGGCCAGCCTGAGTGTGGATTTCCGTCGTCCGGTTCCGGTTCCGACTGATGTGTGGGTCTCT
GCTTGGATTGAGGGCGTGGAGGATCGTAAGGCTTTTATGAGGGCTGAGATGAAGGGCGCTGATGGTGTTGTTTTG
GCTTCTGCGCGGAGCACTTGGATTGCCTTGAAAGAAAAGTTGTAG
Gene >Ophcf2|03066
ATGCGTCCTCCTACCTCCCCGCTTCGCATCGTCTCCCCAGCCCTCGGTCTCATCCCTTCCGATACACCTCCAGAC
CTCTTCGACTCGGCGGTCGCGCACTTCTCGTCCATAGCCTGGGTCGCTGGTCGTCTTCGTCGGCCCGGTGGCATT
CTGTTCATCCCGCAAAGCTTCAACCCCTTGTCGCCGCGCGGAGACCAGTTTATTGGCGACACGCTCGGGAGGAAC
CCCCGCGGTCTACGTCATATGCTCGGCCTCTTCTTCCCAGCTGATGGACAGTTGACCGACGGCACACACCCCGTC
CATCGCATAGAGACGTTCTGCTCCGTGGGTGTCGGACTCTCCGGCTATGAAGACGTCATGCACGGCGGCATGGTC
TGCTCCCTCTTGGACGAAAGCTTCGGAATAGTTCACGAGCTCAACACCGTGCTCGGAAAGCAGCCTCCTGCTGGG
AGGAATCATATGACGGCCAGCCTGAGTGTGGATTTCCGTCGTCCGGTTCCGGTTCCGACTGATGTGTGGGTCTCT
GCTTGGATTGAGGGCGTGGAGGATCGTAAGGCTTTTATGAGGGCTGAGATGAAGGGCGCTGATGGTGTTGTTTTG
GCTTCTGCGCGGAGCACTTGGATTGCCTTGAAAGAAAAGTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail