Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03063
Gene name
Locationscaffold_03:563405..564295
Strand+
Gene length (bp)890
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00574 CLP_protease Clp protease 5.5E-69 24 208

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5478 0.4252 0.0141 0.1739 0.4721 0.0685 0.1664 0.2688 0.0608 0.1496

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2300
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5850
Ophiocordyceps australis map64 (Brazil) OphauB2|6230
Ophiocordyceps camponoti-floridani Ophcf2|03063 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|529
Ophiocordyceps kimflemingae Ophio5|6491
Ophiocordyceps subramaniannii Hirsu2|3060

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03063
MGSSSPPCNNIPMPYIEETSTAGRKTWDIFSKLLQERIICLNGKVDNYMSASIVAQLLWLESDTPDKPIIMYINS
PGGSVTSGMAIYDTMTYIKSPVSTVCVGGAASMAAILLAGGEAGKRYALPHSSIMVHQPLGGTSGQASDILIYAN
QIQRIRDQTNKIMLHHLNKAKGHEKYTLEQVNDLMERDRYMSVDEALEVGVIDEVLTRRMDPQAAQTAEKEGKTQ
*
Coding >Ophcf2|03063
ATGGGCAGCTCGAGCCCACCTTGCAACAACATCCCGATGCCCTACATTGAGGAGACGTCGACGGCTGGCAGAAAG
ACGTGGGATATATTCTCCAAGCTGTTGCAGGAAAGGATCATCTGCCTGAATGGCAAAGTCGACAACTACATGTCG
GCATCCATCGTCGCGCAGCTGCTGTGGCTCGAGTCTGACACCCCCGACAAGCCCATAATCATGTACATCAACTCG
CCCGGCGGGTCTGTCACGTCAGGGATGGCCATATACGATACCATGACATACATCAAGTCACCCGTCTCGACCGTC
TGCGTTGGCGGCGCCGCCTCAATGGCTGCCATCCTTCTAGCCGGCGGCGAGGCCGGCAAGCGATATGCCCTCCCA
CACAGCTCCATCATGGTCCATCAACCCTTGGGCGGCACGTCAGGTCAGGCGTCCGATATTCTCATCTACGCCAAT
CAGATCCAGCGGATACGGGATCAAACCAACAAAATCATGCTGCACCACTTGAACAAGGCCAAGGGCCACGAAAAG
TACACGCTCGAACAGGTAAACGACTTGATGGAGCGCGACCGATACATGTCCGTCGACGAGGCGCTGGAGGTTGGT
GTCATCGATGAGGTGTTGACGAGGAGAATGGATCCACAAGCAGCACAGACGGCTGAAAAGGAGGGAAAGACGCAG
TGA
Transcript >Ophcf2|03063
ATGGGCAGCTCGAGCCCACCTTGCAACAACATCCCGATGCCCTACATTGAGGAGACGTCGACGGCTGGCAGAAAG
ACGTGGGATATATTCTCCAAGCTGTTGCAGGAAAGGATCATCTGCCTGAATGGCAAAGTCGACAACTACATGTCG
GCATCCATCGTCGCGCAGCTGCTGTGGCTCGAGTCTGACACCCCCGACAAGCCCATAATCATGTACATCAACTCG
CCCGGCGGGTCTGTCACGTCAGGGATGGCCATATACGATACCATGACATACATCAAGTCACCCGTCTCGACCGTC
TGCGTTGGCGGCGCCGCCTCAATGGCTGCCATCCTTCTAGCCGGCGGCGAGGCCGGCAAGCGATATGCCCTCCCA
CACAGCTCCATCATGGTCCATCAACCCTTGGGCGGCACGTCAGGTCAGGCGTCCGATATTCTCATCTACGCCAAT
CAGATCCAGCGGATACGGGATCAAACCAACAAAATCATGCTGCACCACTTGAACAAGGCCAAGGGCCACGAAAAG
TACACGCTCGAACAGGTAAACGACTTGATGGAGCGCGACCGATACATGTCCGTCGACGAGGCGCTGGAGGTTGGT
GTCATCGATGAGGTGTTGACGAGGAGAATGGATCCACAAGCAGCACAGACGGCTGAAAAGGAGGGAAAGACGCAG
TGA
Gene >Ophcf2|03063
ATGGGCAGCTCGAGCCCACCTTGCAACAACATCCCGATGCCCTACATTGAGGAGACGTCGGTAAGCAACGATGGC
CAGTATCACGTTCTTTGCCTCGGGCTGACAGACGACAGACGGCTGGCAGAAAGACGTGTGAGTCGTACTCGATCA
TCTTCATTGTCTCTCGATGGCTGCTGAAGCTCAATAGGGGATATATTCTCCAAGCTGTTGCAGGTATTGCTCGCA
GCTTCGACCAACTGGCGCAACCGCTGATTTGCCCGCCAGGAAAGGATCATCTGCCTGAATGGCAAAGTCGACAAC
TACATGTCGGCATCCATCGTCGCGCAGCTGCTGTGGCTCGAGTCTGACACCCCCGACAAGCCCATAATCATGTAC
ATCAACTCGCCCGGCGGGTCTGTCACGTCAGGTTCGTCATGAAAGCGCAGACATCAAGGAGTGCAAGGCTAATAA
CGAGTGCAGGGATGGCCATATACGATACCATGACATACATCAAGTCACCCGTCTCGACCGTCTGCGTTGGCGGCG
CCGCCTCAATGGCTGCCATCCTTCTAGCCGGCGGCGAGGCCGGCAAGCGATATGCCCTCCCACACAGCTCCATCA
TGGTCCATCAACCCTTGGGCGGCACGTCAGGTCAGGCGTCCGATATTCTCATCTACGCCAATCAGATCCAGCGGA
TACGGGATCAAACCAACAAAATCATGCTGCACCACTTGAACAAGGCCAAGGGCCACGAAAAGTACACGCTCGAAC
AGGTAAACGACTTGATGGAGCGCGACCGATACATGTCCGTCGACGAGGCGCTGGAGGTTGGTGTCATCGATGAGG
TGTTGACGAGGAGAATGGATCCACAAGCAGCACAGACGGCTGAAAAGGAGGGAAAGACGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail