Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03057
Gene name
Locationscaffold_03:551911..552967
Strand+
Gene length (bp)1056
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03057
MEKYSQFRDKSTGIAPFLPISTPLSPISILMHGFLFFFRLPIFLGYALCYFIIFHYLPLPVVARKVALWGLMAVP
GIWWVDLQLDGVRRGTLSEQPRERVPHAGSVMAATFTSPIDAVYLAAVFDPIFTVSYPGDRRLRRVGLLGAVAAA
LGPVRTVPPDDDDDAHLNDINDLLAEYPNRVIAVFPECGTTNGKAILPLSPALAQCRPDVHIFPVSIRYDLPDVT
TPVPGQWLAFFWNLLSRPTTCIRVRIAEGRRMDTTNGSNGSPMASPATPQFPRRRIDPRSSVSNEEKRLLDRLGE
SLARLSRVKRVGLTMTDKAAFVAALRGNKA*
Coding >Ophcf2|03057
ATGGAGAAATACAGCCAATTCCGCGATAAATCAACGGGCATCGCGCCCTTCCTCCCCATCTCGACGCCGCTATCC
CCGATTTCGATCTTGATGCATGGCTTTCTCTTCTTCTTCCGGCTGCCCATCTTCCTCGGCTACGCTCTCTGCTAC
TTCATCATCTTTCACTACCTGCCCCTCCCCGTCGTCGCTCGCAAGGTGGCTCTCTGGGGCTTGATGGCCGTGCCC
GGCATCTGGTGGGTCGATCTCCAGCTCGACGGTGTCCGACGGGGTACCCTTTCGGAACAGCCGCGGGAGCGTGTG
CCCCACGCCGGCTCCGTCATGGCCGCTACCTTTACCAGCCCCATCGACGCCGTCTATCTGGCCGCCGTCTTCGAC
CCCATCTTCACCGTTTCCTATCCCGGTGACCGCCGCTTGCGCCGAGTCGGTCTCCTGGGCGCCGTTGCCGCCGCT
CTCGGTCCCGTCCGGACCGTTCCGCCCGACGACGACGACGACGCCCATCTCAACGATATCAACGACCTGCTCGCA
GAGTACCCGAACCGCGTCATCGCCGTGTTCCCCGAGTGCGGCACCACCAACGGCAAGGCCATCTTACCCCTGAGT
CCGGCCCTCGCTCAGTGCAGGCCCGACGTCCACATCTTTCCCGTCAGCATCCGCTACGACCTTCCGGACGTCACC
ACTCCGGTGCCAGGTCAGTGGCTCGCCTTCTTCTGGAATTTGCTCTCTCGCCCGACCACATGCATCCGCGTTCGC
ATCGCAGAAGGTCGCCGTATGGATACTACCAACGGCTCCAATGGCTCCCCAATGGCCAGTCCCGCGACCCCTCAG
TTCCCGAGGAGGCGTATCGACCCGCGCTCCAGCGTCTCCAATGAGGAGAAGCGGCTGCTGGATCGACTGGGCGAG
TCACTGGCTCGTCTCAGCAGGGTCAAGCGCGTTGGATTGACCATGACCGACAAGGCTGCCTTTGTAGCCGCCTTG
CGGGGCAACAAGGCCTGA
Transcript >Ophcf2|03057
ATGGAGAAATACAGCCAATTCCGCGATAAATCAACGGGCATCGCGCCCTTCCTCCCCATCTCGACGCCGCTATCC
CCGATTTCGATCTTGATGCATGGCTTTCTCTTCTTCTTCCGGCTGCCCATCTTCCTCGGCTACGCTCTCTGCTAC
TTCATCATCTTTCACTACCTGCCCCTCCCCGTCGTCGCTCGCAAGGTGGCTCTCTGGGGCTTGATGGCCGTGCCC
GGCATCTGGTGGGTCGATCTCCAGCTCGACGGTGTCCGACGGGGTACCCTTTCGGAACAGCCGCGGGAGCGTGTG
CCCCACGCCGGCTCCGTCATGGCCGCTACCTTTACCAGCCCCATCGACGCCGTCTATCTGGCCGCCGTCTTCGAC
CCCATCTTCACCGTTTCCTATCCCGGTGACCGCCGCTTGCGCCGAGTCGGTCTCCTGGGCGCCGTTGCCGCCGCT
CTCGGTCCCGTCCGGACCGTTCCGCCCGACGACGACGACGACGCCCATCTCAACGATATCAACGACCTGCTCGCA
GAGTACCCGAACCGCGTCATCGCCGTGTTCCCCGAGTGCGGCACCACCAACGGCAAGGCCATCTTACCCCTGAGT
CCGGCCCTCGCTCAGTGCAGGCCCGACGTCCACATCTTTCCCGTCAGCATCCGCTACGACCTTCCGGACGTCACC
ACTCCGGTGCCAGGTCAGTGGCTCGCCTTCTTCTGGAATTTGCTCTCTCGCCCGACCACATGCATCCGCGTTCGC
ATCGCAGAAGGTCGCCGTATGGATACTACCAACGGCTCCAATGGCTCCCCAATGGCCAGTCCCGCGACCCCTCAG
TTCCCGAGGAGGCGTATCGACCCGCGCTCCAGCGTCTCCAATGAGGAGAAGCGGCTGCTGGATCGACTGGGCGAG
TCACTGGCTCGTCTCAGCAGGGTCAAGCGCGTTGGATTGACCATGACCGACAAGGCTGCCTTTGTAGCCGCCTTG
CGGGGCAACAAGGCCTGA
Gene >Ophcf2|03057
ATGGAGAAATACAGCCAATTCCGCGATAAATGTGTCCCCTTCCCCTCCTTAACCTCTCCCTACCCTTCCGCTCGC
TAACGGTCCCGTCCTGAAGCAACGGGCATCGCGCCCTTCCTCCCCATCTCGACGCCGCTATCCCCGATTTCGATC
TTGATGCATGGCTTTCTCTTCTTCTTCCGGCTGCCCATCTTCCTCGGCTACGCTCTCTGCTACTTCATCATCTTT
CACTACCTGCCCCTCCCCGTCGTCGCTCGCAAGGTGGCTCTCTGGGGCTTGATGGCCGTGCCCGGCATCTGGTGG
GTCGATCTCCAGCTCGACGGTGTCCGACGGGGTACCCTTTCGGAACAGCCGCGGGAGCGTGTGCCCCACGCCGGC
TCCGTCATGGCCGCTACCTTTACCAGCCCCATCGACGCCGTCTATCTGGCCGCCGTCTTCGACCCCATCTTCACC
GTTTCCTATCCCGGTGACCGCCGCTTGCGCCGAGTCGGTCTCCTGGGCGCCGTTGCCGCCGCTCTCGGTCCCGTC
CGGACCGTTCCGCCCGACGACGACGACGACGCCCATCTCAACGATATCAACGACCTGCTCGCAGAGTACCCGAAC
CGCGTCATCGCCGTGTTCCCCGAGTGCGGCACCACCAACGGCAAGGCCATCTTACCCCTGAGTCCGGCCCTCGCT
CAGTGCAGGCCCGACGTCCACATCTTTCCCGTCAGCATCCGCTACGACCTTCCGGACGTCACCACTCCGGTGCCA
GGTCAGTGGCTCGCCTTCTTCTGGAATTTGCTCTCTCGCCCGACCACATGCATCCGCGTTCGCATCGCAGAAGGT
CGCCGTATGGATACTACCAACGGCTCCAATGGCTCCCCAATGGCCAGTCCCGCGACCCCTCAGTTCCCGAGGAGG
CGTATCGACCCGCGCTCCAGCGTCTCCAATGAGGAGAAGCGGCTGCTGGATCGACTGGGCGAGTCACTGGCTCGT
CTCAGCAGGGTCAAGCGCGTTGGATTGACCATGACCGACAAGGCTGCCTTTGTAGCCGCCTTGCGGGGCAACAAG
GCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail