Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03054
Gene name
Locationscaffold_03:542642..544786
Strand-
Gene length (bp)2144
Transcript length (bp)1866
Coding sequence length (bp)1866
Protein length (aa) 622

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 2.6E-65 74 383
PF05199 GMC_oxred_C GMC oxidoreductase 6.7E-09 508 604
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.7E-05 78 106

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2482 0.1167 0.8749 0.037 0.1222 0.0495 0.258 0.3654 0.2194 0.0302

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA3_2 2.6E-127 73 608

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5143
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03054 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5079
Ophiocordyceps kimflemingae Ophio5|6480
Ophiocordyceps subramaniannii Hirsu2|3526
Ophiocordyceps subramaniannii Hirsu2|4921

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03054
MIDIGNESRGVAGEDKEEEEEEEMRIWWSAVRLGMATSCRLFSLVVSLIMRFSSVWILGAAAGVAASQDYSDEYD
YVIVGAGVCGLVVANRLSRHGKTVAVIETGTDQRTNQLVRNPLSYWENLRTDINYNYTSEPEDDAQGRVVTIYAG
KGIGGSSLVNGMVYIRGDKAQFDAWERLGNPGWNWEALLPYYKQVEKLQLPEPWQVQRGAIMDAQNHGFSGELHV
GFSPKLYDASAYADLRSAWGSLGLGANGDPNRGDTRGSFLFPHTIDAKQNLRWDAATAFLWPVVNQRRNLRVLRG
TARRVLWKSGGEEEVQAEGVEYVTADGAKVTIRARREVILSAGALRTPLILERSGIGNTRLLAKEGIKTVVHLPG
VGENLMDQAASSITFESKRRLDDPESPTGWGSHQTDGRTSSHAAFVTVRDLFGDEFEKIKEETKRSLSTYALKAA
RDASHGGTEEEIQAWASSVERVLEVQFDLLFSKETTAAELMTFELGNILGSAFWGLIPFSRGSVHIGGPDADRPV
LRPRFTSAEIDKAILVAAGKLAGRIWAHPSLSKLVATQYNPRVEDLPLGRASEEQWRSWAARTLGSGLHPLGTAA
MMERGLGGLWMRGFACLGRGG*
Coding >Ophcf2|03054
ATGATCGATATCGGTAACGAGTCACGGGGAGTTGCTGGAGAGGACAAGGAGGAGGAGGAAGAGGAGGAGATGAGG
ATCTGGTGGTCTGCCGTGCGACTTGGGATGGCAACCAGCTGCCGTCTCTTCTCTCTCGTCGTCTCGCTCATCATG
AGATTCTCCTCCGTCTGGATCCTCGGCGCCGCGGCAGGCGTGGCAGCTAGCCAGGATTACTCAGACGAGTACGAC
TATGTCATCGTCGGAGCCGGAGTGTGCGGCCTCGTCGTGGCCAACCGGCTTTCACGCCATGGAAAGACTGTTGCT
GTCATTGAGACGGGGACGGATCAGCGCACGAATCAGCTCGTGCGCAATCCGCTCTCATACTGGGAGAATCTACGG
ACGGATATCAACTATAACTATACGAGTGAGCCCGAGGACGATGCTCAGGGGAGGGTGGTGACCATCTACGCGGGC
AAGGGGATAGGAGGGTCAAGCTTGGTGAACGGCATGGTCTACATCCGCGGCGACAAGGCCCAGTTCGACGCATGG
GAGAGGCTCGGAAACCCAGGCTGGAACTGGGAGGCACTGCTTCCGTACTACAAGCAAGTCGAGAAGCTCCAGCTC
CCTGAACCATGGCAAGTACAGCGAGGCGCGATCATGGACGCGCAGAACCACGGCTTCTCGGGCGAGCTGCACGTC
GGCTTCTCGCCTAAGCTGTACGATGCAAGCGCGTATGCAGACCTTCGTTCGGCCTGGGGTTCGTTGGGGCTCGGC
GCAAACGGAGATCCTAATCGGGGGGATACGCGCGGGAGCTTCTTGTTCCCTCATACCATCGATGCTAAACAGAAT
CTGCGGTGGGATGCGGCTACGGCGTTTTTGTGGCCGGTTGTGAATCAGAGGCGAAATCTCAGGGTATTAAGGGGG
ACGGCGAGGAGGGTTCTTTGGAAATCGGGGGGGGAGGAGGAGGTTCAGGCTGAGGGCGTTGAGTATGTTACTGCT
GATGGGGCCAAGGTGACGATCCGGGCTCGTCGGGAGGTCATTCTCTCGGCCGGGGCGCTGCGAACGCCTCTCATC
CTCGAGAGATCCGGCATCGGGAACACGAGGCTGTTGGCTAAGGAGGGCATCAAGACGGTCGTCCATCTCCCTGGC
GTGGGAGAGAACCTAATGGACCAGGCAGCTTCGTCCATCACGTTCGAATCCAAGCGGAGGCTCGACGATCCTGAA
TCACCCACGGGTTGGGGCAGTCACCAGACGGACGGACGGACGTCTTCACACGCGGCCTTTGTCACGGTCCGCGAT
CTCTTTGGGGATGAATTCGAGAAGATCAAGGAGGAGACGAAGCGGAGTCTTTCGACGTATGCGCTGAAGGCGGCT
CGCGATGCCAGCCACGGGGGAACGGAGGAGGAGATTCAGGCGTGGGCCTCTTCGGTGGAGCGGGTGCTGGAAGTC
CAGTTCGATCTTCTCTTCAGCAAGGAGACGACGGCGGCGGAGCTGATGACTTTTGAGCTGGGAAATATCCTCGGC
TCTGCTTTCTGGGGGTTAATCCCCTTTAGTCGTGGGAGCGTTCACATCGGAGGTCCAGACGCAGATCGACCGGTT
CTTCGCCCTCGCTTCACATCGGCAGAGATCGACAAGGCCATCCTAGTGGCAGCGGGGAAGCTAGCAGGGCGAATC
TGGGCGCACCCGTCGCTATCGAAGCTGGTGGCGACGCAGTACAACCCGCGGGTCGAGGACCTGCCTCTCGGACGA
GCGAGCGAGGAGCAGTGGCGGTCTTGGGCGGCGAGGACGCTCGGTTCGGGGCTTCATCCGCTGGGGACGGCGGCC
ATGATGGAGAGGGGGTTGGGGGGGTTGTGGATGAGAGGTTTCGCGTGTTTGGGACGGGGGGGTTGA
Transcript >Ophcf2|03054
ATGATCGATATCGGTAACGAGTCACGGGGAGTTGCTGGAGAGGACAAGGAGGAGGAGGAAGAGGAGGAGATGAGG
ATCTGGTGGTCTGCCGTGCGACTTGGGATGGCAACCAGCTGCCGTCTCTTCTCTCTCGTCGTCTCGCTCATCATG
AGATTCTCCTCCGTCTGGATCCTCGGCGCCGCGGCAGGCGTGGCAGCTAGCCAGGATTACTCAGACGAGTACGAC
TATGTCATCGTCGGAGCCGGAGTGTGCGGCCTCGTCGTGGCCAACCGGCTTTCACGCCATGGAAAGACTGTTGCT
GTCATTGAGACGGGGACGGATCAGCGCACGAATCAGCTCGTGCGCAATCCGCTCTCATACTGGGAGAATCTACGG
ACGGATATCAACTATAACTATACGAGTGAGCCCGAGGACGATGCTCAGGGGAGGGTGGTGACCATCTACGCGGGC
AAGGGGATAGGAGGGTCAAGCTTGGTGAACGGCATGGTCTACATCCGCGGCGACAAGGCCCAGTTCGACGCATGG
GAGAGGCTCGGAAACCCAGGCTGGAACTGGGAGGCACTGCTTCCGTACTACAAGCAAGTCGAGAAGCTCCAGCTC
CCTGAACCATGGCAAGTACAGCGAGGCGCGATCATGGACGCGCAGAACCACGGCTTCTCGGGCGAGCTGCACGTC
GGCTTCTCGCCTAAGCTGTACGATGCAAGCGCGTATGCAGACCTTCGTTCGGCCTGGGGTTCGTTGGGGCTCGGC
GCAAACGGAGATCCTAATCGGGGGGATACGCGCGGGAGCTTCTTGTTCCCTCATACCATCGATGCTAAACAGAAT
CTGCGGTGGGATGCGGCTACGGCGTTTTTGTGGCCGGTTGTGAATCAGAGGCGAAATCTCAGGGTATTAAGGGGG
ACGGCGAGGAGGGTTCTTTGGAAATCGGGGGGGGAGGAGGAGGTTCAGGCTGAGGGCGTTGAGTATGTTACTGCT
GATGGGGCCAAGGTGACGATCCGGGCTCGTCGGGAGGTCATTCTCTCGGCCGGGGCGCTGCGAACGCCTCTCATC
CTCGAGAGATCCGGCATCGGGAACACGAGGCTGTTGGCTAAGGAGGGCATCAAGACGGTCGTCCATCTCCCTGGC
GTGGGAGAGAACCTAATGGACCAGGCAGCTTCGTCCATCACGTTCGAATCCAAGCGGAGGCTCGACGATCCTGAA
TCACCCACGGGTTGGGGCAGTCACCAGACGGACGGACGGACGTCTTCACACGCGGCCTTTGTCACGGTCCGCGAT
CTCTTTGGGGATGAATTCGAGAAGATCAAGGAGGAGACGAAGCGGAGTCTTTCGACGTATGCGCTGAAGGCGGCT
CGCGATGCCAGCCACGGGGGAACGGAGGAGGAGATTCAGGCGTGGGCCTCTTCGGTGGAGCGGGTGCTGGAAGTC
CAGTTCGATCTTCTCTTCAGCAAGGAGACGACGGCGGCGGAGCTGATGACTTTTGAGCTGGGAAATATCCTCGGC
TCTGCTTTCTGGGGGTTAATCCCCTTTAGTCGTGGGAGCGTTCACATCGGAGGTCCAGACGCAGATCGACCGGTT
CTTCGCCCTCGCTTCACATCGGCAGAGATCGACAAGGCCATCCTAGTGGCAGCGGGGAAGCTAGCAGGGCGAATC
TGGGCGCACCCGTCGCTATCGAAGCTGGTGGCGACGCAGTACAACCCGCGGGTCGAGGACCTGCCTCTCGGACGA
GCGAGCGAGGAGCAGTGGCGGTCTTGGGCGGCGAGGACGCTCGGTTCGGGGCTTCATCCGCTGGGGACGGCGGCC
ATGATGGAGAGGGGGTTGGGGGGGTTGTGGATGAGAGGTTTCGCGTGTTTGGGACGGGGGGGTTGA
Gene >Ophcf2|03054
ATGATCGATATCGGTAACGAGTCACGGGGAGTTGCTGGAGAGGACAAGGAGGAGGAGGAAGAGGAGGAGATGAGG
ATCTGGTCCGCCACCAACAATGCTTTCTAGGTTGCTTATACGAAGTCGCCCGCCTATAGAGGTGGTCTGCCGTGC
GACTTGGGTAAGCTCTCGGCTTTCCCCCTCGCGACCCCTCACCTCGCGGTCCGAGTAGCTGCTTATTTTGGCGTT
GAAGGATGGCAACCAGTCAGGATAGACACGGAGAGGGGGTTTCTCGCTTATATGGTCCGGTCCAGGCTGCCGTCT
CTTCTCTCTCGTCGTCTCGGTAAGAGAGCAGTCTTTTACGTCTGCCTCAGTTGTAGCTCACGCGTTTCCAGCTCA
TCATGAGATTCTCCTCCGTCTGGATCCTCGGCGCCGCGGCAGGCGTGGCAGCTAGCCAGGATTACTCAGACGAGT
ACGACTATGTCATCGTCGGAGCCGGAGTGTGCGGCCTCGTCGTGGCCAACCGGCTTTCACGCCATGGAAAGACTG
TTGCTGTCATTGAGACGGGGACGGATCAGCGCACGAATCAGCTCGTGCGCAATCCGCTCTCATACTGGGAGAATC
TACGGACGGATATCAACTATAACTATACGAGTGAGCCCGAGGACGATGCTCAGGGGAGGGTGGTGACCATCTACG
CGGGCAAGGGGATAGGAGGGTCAAGCTTGGTGAACGGTAGGCAAATCTGAATATCAACATGAGGGAGGTATCTGA
CGATGGCAGGCATGGTCTACATCCGCGGCGACAAGGCCCAGTTCGACGCATGGGAGAGGCTCGGAAACCCAGGCT
GGAACTGGGAGGCACTGCTTCCGTACTACAAGCAAGTCGAGAAGCTCCAGCTCCCTGAACCATGGCAAGTACAGC
GAGGCGCGATCATGGACGCGCAGAACCACGGCTTCTCGGGCGAGCTGCACGTCGGCTTCTCGCCTAAGCTGTACG
ATGCAAGCGCGTATGCAGACCTTCGTTCGGCCTGGGGTTCGTTGGGGCTCGGCGCAAACGGAGATCCTAATCGGG
GGGATACGCGCGGGAGCTTCTTGTTCCCTCATACCATCGATGCTAAACAGAATCTGCGGTGGGATGCGGCTACGG
CGTTTTTGTGGCCGGTTGTGAATCAGAGGCGAAATCTCAGGGTATTAAGGGGGACGGCGAGGAGGGTTCTTTGGA
AATCGGGGGGGGAGGAGGAGGTTCAGGCTGAGGGCGTTGAGTATGTTACTGCTGATGGGGCCAAGGTGACGATCC
GGGCTCGTCGGGAGGTCATTCTCTCGGCCGGGGCGCTGCGAACGCCTCTCATCCTCGAGAGATCCGGCATCGGGA
ACACGAGGCTGTTGGCTAAGGAGGGCATCAAGACGGTCGTCCATCTCCCTGGCGTGGGAGAGAACCTAATGGACC
AGGCAGCTTCGTCCATCACGTTCGAATCCAAGCGGAGGCTCGACGATCCTGAATCACCCACGGGTTGGGGCAGTC
ACCAGACGGACGGACGGACGTCTTCACACGCGGCCTTTGTCACGGTCCGCGATCTCTTTGGGGATGAATTCGAGA
AGATCAAGGAGGAGACGAAGCGGAGTCTTTCGACGTATGCGCTGAAGGCGGCTCGCGATGCCAGCCACGGGGGAA
CGGAGGAGGAGATTCAGGCGTGGGCCTCTTCGGTGGAGCGGGTGCTGGAAGTCCAGTTCGATCTTCTCTTCAGCA
AGGAGACGACGGCGGCGGAGCTGATGACTTTTGAGCTGGGAAATATCCTCGGCTCTGCTTTCTGGGGGTTAATCC
CCTTTAGTCGTGGGAGCGTTCACATCGGAGGTCCAGACGCAGATCGACCGGTTCTTCGCCCTCGCTTCACATCGG
CAGAGATCGACAAGGCCATCCTAGTGGCAGCGGGGAAGCTAGCAGGGCGAATCTGGGCGCACCCGTCGCTATCGA
AGCTGGTGGCGACGCAGTACAACCCGCGGGTCGAGGACCTGCCTCTCGGACGAGCGAGCGAGGAGCAGTGGCGGT
CTTGGGCGGCGAGGACGCTCGGTTCGGGGCTTCATCCGCTGGGGACGGCGGCCATGATGGAGAGGGGGTTGGGGG
GGTTGTGGATGAGAGGTTTCGCGTGTTTGGGACGGGGGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail