Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03045
Gene name
Locationscaffold_03:525544..526695
Strand+
Gene length (bp)1151
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 5.6E-25 7 125
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 1.6E-21 141 360

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03045
MEGGVIFNVGIIGYGASAKIFHIPFIAVTPQLRLAAIVQRAPSEDSSASRHHPHLRHYNRVQELLADADIDLVIV
TTPPDSHSALTKAALEAGKHVLTEKPFVPTAAEADQLATLARDKKRLLCVYQNRRWDADFLTVQHLIAHQTLGRI
VDFDSHFDRYRPVVPADWKGELELASGGGAVFDLGSHLVDQVYLLFGMPRSVHGRLLSQRRGHVDVVAPDSMSAE
LTYPNGMLAHIRTSVLSVETSQRRFWIRGERGSFHKLDLDPQEDQLKAGCEPTDRDYGPQDIDKMRLILVDGDGV
PTEAKVPTIEAETYSGFYSALARALQSGREEQLPVKIQEVRDVLRILEAIVESAKSGRDVVFG*
Coding >Ophcf2|03045
ATGGAAGGCGGCGTCATCTTCAACGTGGGCATCATTGGTTATGGCGCGTCCGCCAAGATTTTTCACATCCCCTTC
ATCGCCGTCACTCCGCAGCTGCGTCTCGCCGCCATCGTCCAGCGAGCTCCATCTGAGGACAGCTCGGCGTCTCGT
CATCACCCGCATTTGCGACACTATAACCGCGTCCAAGAGTTGCTGGCCGACGCCGACATCGACCTCGTCATCGTC
ACCACGCCGCCAGACAGTCACTCGGCTCTGACCAAGGCCGCGCTCGAGGCTGGCAAGCATGTACTGACAGAGAAG
CCGTTTGTGCCCACGGCAGCCGAGGCCGACCAGCTCGCGACCCTGGCGCGCGATAAGAAGCGGCTCTTGTGCGTC
TATCAGAACCGTCGATGGGACGCCGACTTTTTGACGGTTCAACACCTCATCGCCCACCAGACGCTGGGTCGCATC
GTCGACTTTGACTCGCACTTTGATCGGTACCGGCCCGTAGTCCCAGCAGATTGGAAGGGCGAGCTGGAGTTGGCG
TCAGGCGGAGGCGCCGTCTTCGATCTCGGCTCGCATCTCGTCGACCAGGTCTATCTTCTCTTCGGCATGCCGCGT
TCAGTCCACGGCCGGCTCCTCTCGCAGCGCAGAGGCCATGTCGACGTCGTTGCGCCCGACAGCATGTCGGCTGAG
CTGACGTATCCCAACGGTATGCTCGCGCATATCCGCACCAGCGTTCTCAGCGTAGAGACGTCTCAGCGACGCTTC
TGGATACGTGGAGAGCGCGGTAGCTTCCATAAGCTCGACCTCGATCCGCAGGAGGACCAGCTCAAGGCCGGTTGC
GAGCCAACAGACCGAGACTATGGCCCCCAAGACATCGACAAGATGCGCCTGATTCTCGTCGACGGAGATGGCGTC
CCGACCGAGGCGAAAGTGCCGACCATCGAAGCCGAGACCTATAGCGGCTTCTACTCTGCTCTGGCACGGGCACTG
CAGAGTGGTCGCGAAGAACAGCTCCCGGTCAAGATACAGGAGGTGCGAGATGTGCTGCGTATTCTCGAAGCCATC
GTCGAGAGCGCAAAGTCGGGCAGAGACGTCGTCTTTGGATGA
Transcript >Ophcf2|03045
ATGGAAGGCGGCGTCATCTTCAACGTGGGCATCATTGGTTATGGCGCGTCCGCCAAGATTTTTCACATCCCCTTC
ATCGCCGTCACTCCGCAGCTGCGTCTCGCCGCCATCGTCCAGCGAGCTCCATCTGAGGACAGCTCGGCGTCTCGT
CATCACCCGCATTTGCGACACTATAACCGCGTCCAAGAGTTGCTGGCCGACGCCGACATCGACCTCGTCATCGTC
ACCACGCCGCCAGACAGTCACTCGGCTCTGACCAAGGCCGCGCTCGAGGCTGGCAAGCATGTACTGACAGAGAAG
CCGTTTGTGCCCACGGCAGCCGAGGCCGACCAGCTCGCGACCCTGGCGCGCGATAAGAAGCGGCTCTTGTGCGTC
TATCAGAACCGTCGATGGGACGCCGACTTTTTGACGGTTCAACACCTCATCGCCCACCAGACGCTGGGTCGCATC
GTCGACTTTGACTCGCACTTTGATCGGTACCGGCCCGTAGTCCCAGCAGATTGGAAGGGCGAGCTGGAGTTGGCG
TCAGGCGGAGGCGCCGTCTTCGATCTCGGCTCGCATCTCGTCGACCAGGTCTATCTTCTCTTCGGCATGCCGCGT
TCAGTCCACGGCCGGCTCCTCTCGCAGCGCAGAGGCCATGTCGACGTCGTTGCGCCCGACAGCATGTCGGCTGAG
CTGACGTATCCCAACGGTATGCTCGCGCATATCCGCACCAGCGTTCTCAGCGTAGAGACGTCTCAGCGACGCTTC
TGGATACGTGGAGAGCGCGGTAGCTTCCATAAGCTCGACCTCGATCCGCAGGAGGACCAGCTCAAGGCCGGTTGC
GAGCCAACAGACCGAGACTATGGCCCCCAAGACATCGACAAGATGCGCCTGATTCTCGTCGACGGAGATGGCGTC
CCGACCGAGGCGAAAGTGCCGACCATCGAAGCCGAGACCTATAGCGGCTTCTACTCTGCTCTGGCACGGGCACTG
CAGAGTGGTCGCGAAGAACAGCTCCCGGTCAAGATACAGGAGGTGCGAGATGTGCTGCGTATTCTCGAAGCCATC
GTCGAGAGCGCAAAGTCGGGCAGAGACGTCGTCTTTGGATGA
Gene >Ophcf2|03045
ATGGAAGGCGGCGTCATCTTCAACGTGGGCATCATTGGTTATGGGTATGTCGTCGCATGAGTCGTCCGCGGGCGC
TGACAATCTGTCCATCCTGTCCTGTCAGCGCGTCCGCCAAGATTTTTCACATCCCCTTCATCGCCGTCACTCCGC
AGCTGCGTCTCGCCGCCATCGTCCAGCGAGCTCCATCTGAGGACAGCTCGGCGTCTCGTCATCACCCGCATTTGC
GACACTATAACCGCGTCCAAGAGTTGCTGGCCGACGCCGACATCGACCTCGTCATCGTCACCACGCCGCCAGACA
GTCACTCGGCTCTGACCAAGGCCGCGCTCGAGGCTGGCAAGCATGTACTGACAGAGAAGCCGTTTGTGCCCACGG
CAGCCGAGGCCGACCAGCTCGCGACCCTGGCGCGCGATAAGAAGCGGCTCTTGTGCGTCTATCAGAACCGTCGAT
GGGACGCCGACTTTTTGACGGTTCAACACCTCATCGCCCACCAGACGCTGGGTCGCATCGTCGACTTTGACTCGC
ACTTTGATCGGTACCGGCCCGTAGTCCCAGCAGATTGGAAGGGCGAGCTGGAGTTGGCGTCAGGCGGAGGCGCCG
TCTTCGATCTCGGCTCGCATCTCGTCGACCAGGTCTATCTTCTCTTCGGCATGCCGCGTTCAGTCCACGGCCGGC
TCCTCTCGCAGCGCAGAGGCCATGTCGACGTCGTTGCGCCCGACAGCATGTCGGCTGAGCTGACGTATCCCAACG
GTATGCTCGCGCATATCCGCACCAGCGTTCTCAGCGTAGAGACGTCTCAGCGACGCTTCTGGATACGTGGAGAGC
GCGGTAGCTTCCATAAGCTCGACCTCGATCCGCAGGAGGACCAGCTCAAGGCCGGTTGCGAGCCAACAGACCGAG
ACTATGGCCCCCAAGACATCGACAAGATGCGCCTGATTCTCGTCGACGGAGATGGCGTCCCGACCGAGGCGAAAG
TGCCGACCATCGAAGCCGAGACCTATAGCGGCTTCTACTCTGCTCTGGCACGGGCACTGCAGAGTGGTCGCGAAG
AACAGCTCCCGGTCAAGATACAGGAGGTGCGAGATGTGCTGCGTATTCTCGAAGCCATCGTCGAGAGCGCAAAGT
CGGGCAGAGACGTCGTCTTTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail