Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03044
Gene name
Locationscaffold_03:523891..524432
Strand-
Gene length (bp)541
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.4E-08 20 85

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0585 0.0579 0.8166 0.3439 0.0932 0.0026 0.1392 0.13 0.0967 0.0045

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999641

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup534
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5692
Ophiocordyceps australis map64 (Brazil) OphauB2|6244
Ophiocordyceps camponoti-floridani Ophcf2|03044 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2015
Ophiocordyceps kimflemingae Ophio5|8335
Ophiocordyceps subramaniannii Hirsu2|3333

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03044
MHFSTTTLLSLLATAYADSLSSVPPCAQACVRDAVIGHTSCDVNSLSCICNNVETILPKAAECVAESCTPDQIFN
DVLPNAIQTCTSHTTQLLSRQANVQCVPVAVEPVVTTATAPPNVVTATVRPSATAPVVTAGAAAAVAPGGLAALA
VAAVLL*
Coding >Ophcf2|03044
ATGCACTTCTCAACAACCACCCTCCTCTCCCTCCTCGCCACCGCCTACGCCGACTCCCTCTCTTCCGTGCCCCCC
TGCGCCCAAGCCTGCGTCCGCGACGCCGTAATAGGCCACACCTCGTGCGACGTCAACTCCCTCTCCTGCATCTGC
AACAACGTGGAGACCATCCTCCCCAAGGCCGCAGAATGCGTCGCCGAGTCCTGCACCCCCGATCAAATCTTCAAC
GACGTCCTCCCCAACGCAATCCAAACCTGCACCTCTCACACAACCCAGCTCCTCTCCCGACAAGCAAACGTACAA
TGCGTGCCCGTCGCCGTCGAGCCCGTCGTCACCACGGCGACGGCGCCCCCCAACGTCGTCACCGCCACCGTCAGA
CCCTCCGCCACCGCTCCCGTCGTCACCGCCGGGGCCGCGGCCGCCGTCGCGCCGGGGGGGTTGGCGGCTTTGGCC
GTCGCCGCTGTTCTTTTGTAG
Transcript >Ophcf2|03044
ATGCACTTCTCAACAACCACCCTCCTCTCCCTCCTCGCCACCGCCTACGCCGACTCCCTCTCTTCCGTGCCCCCC
TGCGCCCAAGCCTGCGTCCGCGACGCCGTAATAGGCCACACCTCGTGCGACGTCAACTCCCTCTCCTGCATCTGC
AACAACGTGGAGACCATCCTCCCCAAGGCCGCAGAATGCGTCGCCGAGTCCTGCACCCCCGATCAAATCTTCAAC
GACGTCCTCCCCAACGCAATCCAAACCTGCACCTCTCACACAACCCAGCTCCTCTCCCGACAAGCAAACGTACAA
TGCGTGCCCGTCGCCGTCGAGCCCGTCGTCACCACGGCGACGGCGCCCCCCAACGTCGTCACCGCCACCGTCAGA
CCCTCCGCCACCGCTCCCGTCGTCACCGCCGGGGCCGCGGCCGCCGTCGCGCCGGGGGGGTTGGCGGCTTTGGCC
GTCGCCGCTGTTCTTTTGTAG
Gene >Ophcf2|03044
ATGCACTTCTCAACAACCACCCTCCTCTCCCTCCTCGCCACCGCCTACGCCGACTCCCTCTCTTCCGTGCCCCCC
TGCGCCCAAGCCTGCGTCCGCGACGCCGTAATAGGCCACACCTCGTGCGACGTCAACTCCCTCTCCTGCATCTGC
AACAACGTGGAGACCATCCTCCCCAAGGCCGCAGAATGCGTCGCCGAGTCCTGCACCCCCGATCAAATCTTCAGT
ACCTCTACCCTCTCTCAACCCTTCAATCCAAGACACGATAGCTAACACTCCCCCCCCCCCCCCACCAGACGACGT
CCTCCCCAACGCAATCCAAACCTGCACCTCTCACACAACCCAGCTCCTCTCCCGACAAGCAAACGTACAATGCGT
GCCCGTCGCCGTCGAGCCCGTCGTCACCACGGCGACGGCGCCCCCCAACGTCGTCACCGCCACCGTCAGACCCTC
CGCCACCGCTCCCGTCGTCACCGCCGGGGCCGCGGCCGCCGTCGCGCCGGGGGGGTTGGCGGCTTTGGCCGTCGC
CGCTGTTCTTTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail