Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03043
Gene name
Locationscaffold_03:517167..523291
Strand+
Gene length (bp)6124
Transcript length (bp)4617
Coding sequence length (bp)4617
Protein length (aa) 1539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16275 SF1-HH Splicing factor 1 helix-hairpin domain 2.5E-42 57 166
PF04389 Peptidase_M28 Peptidase family M28 1.7E-35 803 975
PF00098 zf-CCHC Zinc knuckle 2.0E-04 295 311
PF00098 zf-CCHC Zinc knuckle 4.0E-05 320 335
PF00013 KH_1 KH domain 9.5E-07 186 257

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 1028 1050 22
2 1079 1101 22
3 1114 1136 22
4 1148 1165 17
5 1175 1197 22
6 1317 1339 22
7 1349 1371 22
8 1378 1400 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03043
MAWRNQGITGSNNIPLGKSRRFGGEAEDDVYERGDHKRGRDPEPRGEGDEPRRRKKRNRWAEASENKAAGLMGLP
TAILSNMTSEQLEAYTLHLRIEEISQKLRIDDVVPADGDRSPSPPPSYDNHGRRINTREYRYRKRLEDERHKLIE
RAMKTIPNYHPPQDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMEADSGAKIAIRGKGSVKEGKGRS
DAAHSSNQEEDLHCLIMADTEEKINKAKQLIHNVIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCG
KIGHRKYDCPERQNYTASIICRVCGNAGHMARDCPDRQRGASWRNNDSNGGRHAGRIGGPPGSGDAVDREMEQLM
QELGGGPSAPARIEAGPGGHGGHGGHGGHGGHGGHGGHGGHGGHGGHDEGDVKPWQRGPSGGGPAPWRSRHHDGH
DGPAGGGNSGGNSGGNSGGVGSGGGSGGGGGGGGGGGGGGGGGPAPWARERHRGHDQHGGNSGHYGQHGDGHHDH
SYGSGAGGPPGWHQAAPGTQGGYGGYGYNNYGGPPGMGAAPGPPPGLAPSDGHRGSYQQYPGAPPPPPPPPPPPR
SGNSPRRLPATSRRRLLPPAHRMSPSMKLGNPFAFGPGPVTFWTTAVYLAVVMPLIYVHETVPPAPADDALARGL
NLTEAWMDLQAITKAYHPYDSRENDGVRRYLLQRVSKILDRNGVDYTLERSASSSGDSMGGSADESSGAAIFDDR
VSNVTYTYPTASGGAGEYFEGSNVYVYIRGKEDPAGYWWRRKQSMDFSRHTGGVLVNCHLDSVSVGYGATDDGVA
CVSMLQLLSYFTSEGRQPKYGIVLLFNNAEEDGLLGARAFGDSPLLGFCRTFVNLEGAGAGGRAMLFRSTDLETA
KAYSGSPHPFGSVVAANAFEQGIIKSDTDYSVFAGVYGQRGIDIAFYQPRSRYHTIEDDARHTSTDSVWHMLSAA
VASTETLSATTGTDFQGPRSDGRKDLAQNGRPTEGVWFDVFGSAWAAFPLRGLFAWSLTLLVATPLMLFLVSYLL
ARSDKYYFFATEVEDVEGEPVALRGWRGFFRYPLALVFAVGLTVASVLLVAKVNPLIIHSSSYAVWAMVISLFYL
SFWLIARGASFVRPSALQRGFALLWLYILCWALQVAAAVAEDRLHIGALYFAALLHTAVFVSLMVSLLELFALPS
KRDFGLAQSIDDGSSRHSSGEQSRQSRGGEGNEDEDEDEDEDEDEADEATETTPLRAGEAGYGSGENTTTFASTY
RRSVAAEASSSPSITRPHGPAPYLGEQGWSGRLPSSTWLLQLLLLAPVHLMTLGNLGLVQTTAMAMTGPDGNSVS
IPLLAVAVTAILLLLPLTPFLHRVTHHVPLFLLAVLVGTLAYNLFAFPFSAASRFKFRFQQIVDIDNGTNTVIVT
GLDPFVRPVVAALPSAAGQRIACPASTISNLVDCHYDASSLPPRPVNGTKLEDLVRVEASRSGDGRGARLEIRAR
GSRLCHVDLERAAFDFGVEGGGGGMLASASRPGRDSGG*
Coding >Ophcf2|03043
ATGGCGTGGAGAAATCAGGGCATCACGGGTTCCAACAACATTCCGCTCGGCAAGTCGCGACGCTTTGGCGGTGAG
GCTGAGGACGATGTCTACGAACGCGGCGATCATAAGCGCGGTCGTGATCCTGAGCCCCGCGGCGAGGGTGATGAA
CCTCGTCGGCGGAAGAAACGAAATCGCTGGGCTGAAGCTTCGGAGAATAAAGCTGCTGGTCTGATGGGCCTTCCT
ACCGCCATTCTTTCCAACATGACGAGCGAGCAGCTCGAGGCCTATACCCTTCACCTTCGCATCGAGGAGATCAGT
CAAAAACTTAGGATCGATGACGTTGTCCCTGCTGACGGTGACCGGTCGCCTTCTCCCCCGCCTAGTTATGACAAC
CATGGGCGGCGTATCAACACGCGCGAGTATCGCTATCGCAAGCGACTCGAAGACGAGCGGCATAAGCTCATCGAG
CGAGCCATGAAAACGATTCCGAATTATCATCCGCCCCAGGACTATCGACGTCCTACCAAGACGCAGGAAAAAGTC
TACGTGCCGGTCAATGATTATCCGGAAATCAACTTCATCGGTTTACTCATCGGACCCCGTGGCAATACCCTCAAG
AAAATGGAAGCGGACTCGGGTGCCAAGATTGCCATTCGCGGAAAGGGCTCCGTCAAGGAGGGCAAAGGTCGATCC
GATGCCGCCCATTCCAGCAACCAGGAAGAAGATCTCCACTGCCTCATCATGGCAGACACGGAGGAGAAGATCAAC
AAAGCCAAGCAGTTGATCCACAATGTCATAGAGACGGCTGCCTCGATCCCGGAAGGGCAAAACGAGCTCAAGCGT
AATCAGCTCAGAGAACTAGCTGCGCTCAACGGAACACTGCGTGATGACGAGAATCAGGCTTGTCAGAATTGCGGA
AAGATTGGACATCGCAAGTATGACTGTCCCGAGAGGCAGAACTACACGGCTAGCATCATCTGTCGAGTTTGCGGC
AACGCCGGTCACATGGCGCGCGACTGTCCCGACCGTCAGAGGGGTGCCAGCTGGCGCAACAATGACTCCAACGGC
GGACGTCATGCCGGCAGAATCGGCGGTCCTCCCGGCAGCGGTGATGCTGTTGATCGCGAGATGGAGCAACTCATG
CAAGAACTCGGCGGAGGCCCTAGCGCTCCTGCGCGGATCGAAGCTGGACCGGGTGGCCATGGTGGTCACGGCGGA
CATGGCGGCCACGGCGGACATGGCGGCCACGGCGGACATGGCGGCCACGGCGGACATGGTGGTCATGATGAAGGC
GACGTCAAGCCTTGGCAACGCGGTCCGTCCGGCGGTGGACCTGCTCCTTGGCGCTCGCGTCACCACGACGGCCAC
GACGGACCGGCTGGCGGCGGCAACAGCGGCGGCAACAGCGGCGGCAACAGCGGCGGTGTTGGTAGTGGCGGTGGC
AGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCCAGCTCCTTGGGCTCGCGAG
CGTCACCGTGGACACGACCAGCACGGCGGCAACTCGGGTCACTACGGACAACACGGCGACGGTCATCACGACCAC
TCGTACGGCTCCGGCGCTGGAGGACCCCCGGGCTGGCACCAGGCTGCTCCCGGCACGCAGGGCGGCTACGGCGGC
TACGGCTACAACAACTATGGCGGCCCTCCCGGAATGGGTGCTGCTCCCGGCCCGCCTCCCGGCCTCGCCCCCTCT
GACGGACATCGCGGGTCGTATCAGCAGTATCCCGGCGCGCCTCCTCCTCCTCCGCCTCCGCCTCCGCCTCCGCGG
TCTGGCAATTCGCCCCGCCGCCTCCCAGCAACCAGCCGCCGCCGCCTCCTCCCCCCGGCGCATAGGATGTCACCG
AGCATGAAGCTCGGTAATCCATTTGCCTTCGGGCCCGGCCCCGTCACCTTCTGGACGACGGCCGTCTACCTCGCC
GTCGTCATGCCGCTGATATACGTACACGAGACGGTCCCTCCCGCGCCGGCCGATGATGCTCTCGCCCGTGGCCTC
AACCTGACGGAGGCATGGATGGACCTCCAGGCCATTACCAAGGCATACCATCCTTACGATAGCCGCGAGAATGAT
GGCGTCCGTCGCTATCTTCTCCAACGTGTCTCGAAGATCCTGGACCGAAACGGCGTTGACTACACCCTCGAGCGT
AGCGCCAGTTCGAGCGGTGACTCGATGGGCGGATCCGCTGACGAGAGTTCGGGAGCTGCCATCTTCGACGACCGC
GTCTCCAACGTCACCTACACCTACCCGACTGCTTCAGGAGGAGCCGGCGAGTACTTTGAAGGCAGCAACGTATAC
GTCTATATCCGCGGCAAGGAAGACCCCGCGGGCTACTGGTGGAGGCGAAAGCAATCGATGGATTTCTCGCGGCAT
ACTGGAGGCGTGCTGGTCAACTGTCACTTGGACTCGGTCTCGGTCGGCTACGGCGCGACGGACGATGGTGTGGCT
TGCGTGTCAATGCTTCAGCTGCTGAGCTACTTTACGTCTGAAGGTCGTCAGCCCAAGTACGGCATCGTCCTGCTC
TTCAACAACGCCGAAGAGGACGGTCTTCTCGGGGCGCGAGCGTTTGGCGATAGCCCCTTGCTCGGCTTCTGCCGG
ACTTTTGTCAACCTCGAGGGCGCGGGCGCCGGCGGGCGTGCCATGCTCTTCCGGTCGACGGACCTCGAGACGGCC
AAGGCGTATTCCGGGAGTCCGCATCCGTTCGGGTCCGTGGTTGCGGCCAACGCTTTCGAGCAGGGAATCATCAAG
AGCGATACCGACTACTCCGTCTTTGCCGGGGTCTATGGCCAGCGAGGCATCGACATCGCCTTTTATCAGCCCAGG
TCGCGGTACCACACGATAGAGGACGACGCGCGCCACACGTCGACGGACAGCGTGTGGCACATGTTGTCGGCGGCT
GTGGCCTCGACCGAGACGCTTTCGGCCACGACGGGGACCGACTTTCAGGGCCCTCGCTCTGACGGGAGGAAGGAC
CTCGCGCAGAATGGAAGGCCGACCGAGGGCGTCTGGTTCGACGTCTTTGGCAGCGCGTGGGCGGCATTTCCGCTT
AGGGGGCTGTTTGCCTGGTCCCTGACGCTGCTCGTGGCGACGCCGTTGATGCTCTTTCTCGTTTCTTACCTGCTG
GCTCGCAGCGACAAGTACTACTTCTTCGCCACCGAGGTCGAAGATGTCGAGGGCGAGCCCGTGGCGCTCAGGGGC
TGGAGGGGCTTCTTTCGCTATCCGCTTGCTCTGGTCTTTGCCGTCGGTTTGACGGTGGCTTCGGTGTTGCTGGTG
GCGAAGGTGAATCCGCTCATCATCCACAGCAGCAGCTACGCAGTATGGGCCATGGTCATCTCGCTGTTCTACCTT
TCCTTCTGGCTCATCGCCCGCGGCGCCAGCTTCGTCCGGCCCAGCGCCCTGCAGCGAGGCTTCGCCCTTCTGTGG
CTGTACATCCTCTGCTGGGCCTTGCAGGTGGCGGCGGCCGTGGCCGAGGATCGGCTTCATATCGGAGCCCTGTAC
TTTGCCGCCCTGTTGCACACGGCCGTCTTTGTGAGCCTGATGGTGTCTCTGCTCGAGCTGTTCGCGCTGCCTTCC
AAGCGCGACTTTGGGCTGGCACAGAGCATCGACGACGGCTCGAGTCGGCATTCGTCGGGGGAGCAGAGCCGTCAG
AGTCGGGGGGGGGAGGGGAACGAGGACGAGGACGAGGACGAGGACGAGGATGAGGACGAGGCTGACGAGGCTACG
GAGACGACGCCGCTGCGGGCTGGTGAAGCGGGCTACGGCTCGGGTGAGAACACGACGACGTTTGCTAGCACCTAC
AGACGGTCTGTTGCCGCCGAGGCATCGTCGTCACCGTCTATCACTCGACCGCACGGTCCGGCTCCGTACCTGGGC
GAGCAGGGCTGGTCAGGCCGTCTGCCCTCGTCGACGTGGCTTCTGCAGCTGCTGCTCCTAGCTCCGGTCCATCTG
ATGACCCTCGGCAACCTCGGGCTCGTGCAGACGACGGCCATGGCCATGACGGGTCCGGATGGGAACAGCGTCTCG
ATTCCTCTCCTAGCCGTCGCCGTGACCGCCATCCTCCTTCTCCTCCCCCTGACGCCCTTTTTGCACCGGGTGACG
CACCACGTCCCCCTATTCCTCCTCGCCGTCTTGGTCGGCACCCTCGCCTATAACCTATTCGCCTTTCCCTTTTCC
GCCGCCAGCAGGTTCAAGTTCCGCTTCCAGCAGATCGTCGATATCGACAACGGCACCAACACGGTGATTGTGACG
GGTCTAGACCCCTTCGTCCGTCCCGTCGTCGCTGCGTTACCCTCGGCGGCGGGTCAGAGGATCGCCTGTCCGGCC
TCGACCATCAGTAACCTCGTCGACTGCCACTACGACGCGTCTTCCCTGCCGCCTCGACCCGTCAACGGCACGAAG
CTCGAGGACCTGGTGCGGGTGGAAGCTTCGAGGTCGGGCGACGGTCGCGGCGCGCGCCTCGAGATCCGAGCTCGG
GGGTCGAGGCTCTGCCACGTCGACCTCGAGAGGGCGGCGTTCGACTTTGGCGTCGAGGGCGGGGGGGGAGGGATG
CTCGCTTCGGCGTCTCGCCCGGGGAGGGATTCCGGAGGGTGA
Transcript >Ophcf2|03043
ATGGCGTGGAGAAATCAGGGCATCACGGGTTCCAACAACATTCCGCTCGGCAAGTCGCGACGCTTTGGCGGTGAG
GCTGAGGACGATGTCTACGAACGCGGCGATCATAAGCGCGGTCGTGATCCTGAGCCCCGCGGCGAGGGTGATGAA
CCTCGTCGGCGGAAGAAACGAAATCGCTGGGCTGAAGCTTCGGAGAATAAAGCTGCTGGTCTGATGGGCCTTCCT
ACCGCCATTCTTTCCAACATGACGAGCGAGCAGCTCGAGGCCTATACCCTTCACCTTCGCATCGAGGAGATCAGT
CAAAAACTTAGGATCGATGACGTTGTCCCTGCTGACGGTGACCGGTCGCCTTCTCCCCCGCCTAGTTATGACAAC
CATGGGCGGCGTATCAACACGCGCGAGTATCGCTATCGCAAGCGACTCGAAGACGAGCGGCATAAGCTCATCGAG
CGAGCCATGAAAACGATTCCGAATTATCATCCGCCCCAGGACTATCGACGTCCTACCAAGACGCAGGAAAAAGTC
TACGTGCCGGTCAATGATTATCCGGAAATCAACTTCATCGGTTTACTCATCGGACCCCGTGGCAATACCCTCAAG
AAAATGGAAGCGGACTCGGGTGCCAAGATTGCCATTCGCGGAAAGGGCTCCGTCAAGGAGGGCAAAGGTCGATCC
GATGCCGCCCATTCCAGCAACCAGGAAGAAGATCTCCACTGCCTCATCATGGCAGACACGGAGGAGAAGATCAAC
AAAGCCAAGCAGTTGATCCACAATGTCATAGAGACGGCTGCCTCGATCCCGGAAGGGCAAAACGAGCTCAAGCGT
AATCAGCTCAGAGAACTAGCTGCGCTCAACGGAACACTGCGTGATGACGAGAATCAGGCTTGTCAGAATTGCGGA
AAGATTGGACATCGCAAGTATGACTGTCCCGAGAGGCAGAACTACACGGCTAGCATCATCTGTCGAGTTTGCGGC
AACGCCGGTCACATGGCGCGCGACTGTCCCGACCGTCAGAGGGGTGCCAGCTGGCGCAACAATGACTCCAACGGC
GGACGTCATGCCGGCAGAATCGGCGGTCCTCCCGGCAGCGGTGATGCTGTTGATCGCGAGATGGAGCAACTCATG
CAAGAACTCGGCGGAGGCCCTAGCGCTCCTGCGCGGATCGAAGCTGGACCGGGTGGCCATGGTGGTCACGGCGGA
CATGGCGGCCACGGCGGACATGGCGGCCACGGCGGACATGGCGGCCACGGCGGACATGGTGGTCATGATGAAGGC
GACGTCAAGCCTTGGCAACGCGGTCCGTCCGGCGGTGGACCTGCTCCTTGGCGCTCGCGTCACCACGACGGCCAC
GACGGACCGGCTGGCGGCGGCAACAGCGGCGGCAACAGCGGCGGCAACAGCGGCGGTGTTGGTAGTGGCGGTGGC
AGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCCAGCTCCTTGGGCTCGCGAG
CGTCACCGTGGACACGACCAGCACGGCGGCAACTCGGGTCACTACGGACAACACGGCGACGGTCATCACGACCAC
TCGTACGGCTCCGGCGCTGGAGGACCCCCGGGCTGGCACCAGGCTGCTCCCGGCACGCAGGGCGGCTACGGCGGC
TACGGCTACAACAACTATGGCGGCCCTCCCGGAATGGGTGCTGCTCCCGGCCCGCCTCCCGGCCTCGCCCCCTCT
GACGGACATCGCGGGTCGTATCAGCAGTATCCCGGCGCGCCTCCTCCTCCTCCGCCTCCGCCTCCGCCTCCGCGG
TCTGGCAATTCGCCCCGCCGCCTCCCAGCAACCAGCCGCCGCCGCCTCCTCCCCCCGGCGCATAGGATGTCACCG
AGCATGAAGCTCGGTAATCCATTTGCCTTCGGGCCCGGCCCCGTCACCTTCTGGACGACGGCCGTCTACCTCGCC
GTCGTCATGCCGCTGATATACGTACACGAGACGGTCCCTCCCGCGCCGGCCGATGATGCTCTCGCCCGTGGCCTC
AACCTGACGGAGGCATGGATGGACCTCCAGGCCATTACCAAGGCATACCATCCTTACGATAGCCGCGAGAATGAT
GGCGTCCGTCGCTATCTTCTCCAACGTGTCTCGAAGATCCTGGACCGAAACGGCGTTGACTACACCCTCGAGCGT
AGCGCCAGTTCGAGCGGTGACTCGATGGGCGGATCCGCTGACGAGAGTTCGGGAGCTGCCATCTTCGACGACCGC
GTCTCCAACGTCACCTACACCTACCCGACTGCTTCAGGAGGAGCCGGCGAGTACTTTGAAGGCAGCAACGTATAC
GTCTATATCCGCGGCAAGGAAGACCCCGCGGGCTACTGGTGGAGGCGAAAGCAATCGATGGATTTCTCGCGGCAT
ACTGGAGGCGTGCTGGTCAACTGTCACTTGGACTCGGTCTCGGTCGGCTACGGCGCGACGGACGATGGTGTGGCT
TGCGTGTCAATGCTTCAGCTGCTGAGCTACTTTACGTCTGAAGGTCGTCAGCCCAAGTACGGCATCGTCCTGCTC
TTCAACAACGCCGAAGAGGACGGTCTTCTCGGGGCGCGAGCGTTTGGCGATAGCCCCTTGCTCGGCTTCTGCCGG
ACTTTTGTCAACCTCGAGGGCGCGGGCGCCGGCGGGCGTGCCATGCTCTTCCGGTCGACGGACCTCGAGACGGCC
AAGGCGTATTCCGGGAGTCCGCATCCGTTCGGGTCCGTGGTTGCGGCCAACGCTTTCGAGCAGGGAATCATCAAG
AGCGATACCGACTACTCCGTCTTTGCCGGGGTCTATGGCCAGCGAGGCATCGACATCGCCTTTTATCAGCCCAGG
TCGCGGTACCACACGATAGAGGACGACGCGCGCCACACGTCGACGGACAGCGTGTGGCACATGTTGTCGGCGGCT
GTGGCCTCGACCGAGACGCTTTCGGCCACGACGGGGACCGACTTTCAGGGCCCTCGCTCTGACGGGAGGAAGGAC
CTCGCGCAGAATGGAAGGCCGACCGAGGGCGTCTGGTTCGACGTCTTTGGCAGCGCGTGGGCGGCATTTCCGCTT
AGGGGGCTGTTTGCCTGGTCCCTGACGCTGCTCGTGGCGACGCCGTTGATGCTCTTTCTCGTTTCTTACCTGCTG
GCTCGCAGCGACAAGTACTACTTCTTCGCCACCGAGGTCGAAGATGTCGAGGGCGAGCCCGTGGCGCTCAGGGGC
TGGAGGGGCTTCTTTCGCTATCCGCTTGCTCTGGTCTTTGCCGTCGGTTTGACGGTGGCTTCGGTGTTGCTGGTG
GCGAAGGTGAATCCGCTCATCATCCACAGCAGCAGCTACGCAGTATGGGCCATGGTCATCTCGCTGTTCTACCTT
TCCTTCTGGCTCATCGCCCGCGGCGCCAGCTTCGTCCGGCCCAGCGCCCTGCAGCGAGGCTTCGCCCTTCTGTGG
CTGTACATCCTCTGCTGGGCCTTGCAGGTGGCGGCGGCCGTGGCCGAGGATCGGCTTCATATCGGAGCCCTGTAC
TTTGCCGCCCTGTTGCACACGGCCGTCTTTGTGAGCCTGATGGTGTCTCTGCTCGAGCTGTTCGCGCTGCCTTCC
AAGCGCGACTTTGGGCTGGCACAGAGCATCGACGACGGCTCGAGTCGGCATTCGTCGGGGGAGCAGAGCCGTCAG
AGTCGGGGGGGGGAGGGGAACGAGGACGAGGACGAGGACGAGGACGAGGATGAGGACGAGGCTGACGAGGCTACG
GAGACGACGCCGCTGCGGGCTGGTGAAGCGGGCTACGGCTCGGGTGAGAACACGACGACGTTTGCTAGCACCTAC
AGACGGTCTGTTGCCGCCGAGGCATCGTCGTCACCGTCTATCACTCGACCGCACGGTCCGGCTCCGTACCTGGGC
GAGCAGGGCTGGTCAGGCCGTCTGCCCTCGTCGACGTGGCTTCTGCAGCTGCTGCTCCTAGCTCCGGTCCATCTG
ATGACCCTCGGCAACCTCGGGCTCGTGCAGACGACGGCCATGGCCATGACGGGTCCGGATGGGAACAGCGTCTCG
ATTCCTCTCCTAGCCGTCGCCGTGACCGCCATCCTCCTTCTCCTCCCCCTGACGCCCTTTTTGCACCGGGTGACG
CACCACGTCCCCCTATTCCTCCTCGCCGTCTTGGTCGGCACCCTCGCCTATAACCTATTCGCCTTTCCCTTTTCC
GCCGCCAGCAGGTTCAAGTTCCGCTTCCAGCAGATCGTCGATATCGACAACGGCACCAACACGGTGATTGTGACG
GGTCTAGACCCCTTCGTCCGTCCCGTCGTCGCTGCGTTACCCTCGGCGGCGGGTCAGAGGATCGCCTGTCCGGCC
TCGACCATCAGTAACCTCGTCGACTGCCACTACGACGCGTCTTCCCTGCCGCCTCGACCCGTCAACGGCACGAAG
CTCGAGGACCTGGTGCGGGTGGAAGCTTCGAGGTCGGGCGACGGTCGCGGCGCGCGCCTCGAGATCCGAGCTCGG
GGGTCGAGGCTCTGCCACGTCGACCTCGAGAGGGCGGCGTTCGACTTTGGCGTCGAGGGCGGGGGGGGAGGGATG
CTCGCTTCGGCGTCTCGCCCGGGGAGGGATTCCGGAGGGTGA
Gene >Ophcf2|03043
ATGGCGTGGAGAAATCAGGGCATCACGGGTTCCAACAACATTCCGCTCGGCAAGTCGCGACGCTTTGGCGGTGAG
GCTGAGGACGATGTCTACGAACGCGGCGATCATAAGCGCGGTCGTGATCCTGAGCCCCGCGGCGAGGGTGATGAA
CCTCGTCGGCGGAAGAAACGAAATCGCTGGGCTGAAGCTTCGGAGAATAAAGCTGCTGGTCTGATGGGCCTTCCT
ACCGCCATTCTTTCCAACATGACGAGCGAGCAGCTCGAGGCCTATACCCTTCACCTTCGCATCGAGGAGATCAGT
CAAAAACTTAGGATCGATGACGTTGTCCCTGCTGACGGTGACCGGTGAGTCCTATCTCATTTTGTCTTCCCTTTT
CTCTGCCTTTTTTTTTTTTTTTTTTTTTCCCCACCCGTGGAAGTTTTCGCTTGGCTGACTTTCTTTGTCTTTTCT
AGGTCGCCTTCTCCCCCGCCTAGTTATGACAACCATGGGCGGCGTATCAACACGCGCGAGTATCGCTATCGCAAG
CGACTCGAAGACGAGCGGCATAAGCTCATCGAGCGAGCCATGAAAACGATTCCGAATTATCATCCGCCCCAGGAC
TATCGACGTCCTACCAAGACGCAGGAAAAAGTCTACGTGCCGGTCAATGATTATCCGGAAATCAACTTCAGTATG
ATTGCAAACTCCCCCCCCCACCCCCAAATCTCACTCCCTTTCCCTTTCATTTCCGTTCTTCACATTTGCACCAGG
TCTTTTGTTCACTCACTCGTTTCCTTACTTACTGCATCCTCGCTTCGGGGCTCGCCCTGGTCATCTAACTGCTAA
ACACCTGAAAGACTTTCGCTAACATCTAGGTTCAAGTCGGTTTACTCATCGGACCCCGTGGCAATACCCTCAAGA
AAATGGAAGCGGACTCGGGTGCCAAGATTGCCATTCGCGGAAAGGGCTCCGTCAAGGAGGGCAAAGGTCGATCCG
ATGCCGCCCATTCCAGCAACCAGGAAGAAGATCTCCACTGCCTCATCATGGCAGACACGGAGGAGAAGATCAACA
AAGCCAAGCAGTTGATCCACAATGTCATAGAGACGGTGAGTCTTGGGATATAACTCGCCAAGCTACCCGCTTCAT
CTAACGCTGTTCTTCAGGCTGCCTCGATCCCGGAAGGGCAAAACGAGCTCAAGCGTAATCAGCTCAGAGAACTAG
CTGCGCTCAACGGAACACTGCGTGATGACGAGAATCAGGCTTGTCAGAATTGCGGAAAGATTGGACATCGCAAGT
ATGACTGTCCCGAGAGGCAGAACTACACGGCTAGCATCATCTGTCGAGTTTGCGGCAACGCCGGTCACATGGCGC
GCGACTGTCCCGACCGTCAGAGGGGTGCCAGCTGGCGCAACAATGACTCCAACGGCGGACGTCATGCCGGCAGAA
TCGGCGGTCCTCCCGGCAGCGGTGATGCTGTTGATCGCGAGATGGAGGTGCGTCGCATTTCATACCACGAGCGCG
TTGCGCCTATGCGTTAGGTCTTGGCTGACGATGACCCTAGCAACTCATGCAAGAACTCGGCGGAGGCCCTAGCGC
TCCTGCGCGGATCGAAGCTGGACCGGGTGGCCATGGTGGTCACGGCGGACATGGCGGCCACGGCGGACATGGCGG
CCACGGCGGACATGGCGGCCACGGCGGACATGGTGGTCATGATGAAGGCGACGTCAAGCCTTGGCAACGCGGTCC
GTCCGGCGGTGGACCTGCTCCTTGGCGCTCGCGTCACCACGACGGCCACGACGGACCGGCTGGCGGCGGCAACAG
CGGCGGCAACAGCGGCGGCAACAGCGGCGGTGTTGGTAGTGGCGGTGGCAGTGGCGGCGGCGGCGGCGGCGGCGG
CGGCGGCGGCGGCGGCGGCGGCGGCGGCCCAGCTCCTTGGGCTCGCGAGCGTCACCGTGGACACGACCAGCACGG
CGGCAACTCGGGTCACTACGGACAACACGGCGACGGTCATCACGACCACTCGTACGGCTCCGGCGCTGGAGGACC
CCCGGGCTGGCACCAGGCTGCTCCCGGCACGCAGGGCGGCTACGGCGGCTACGGCTACAACAACTATGGCGGCCC
TCCCGGAATGGGTGCTGCTCCCGGCCCGCCTCCCGGCCTCGCCCCCTCTGACGGACATCGCGGGTCGTATCAGCA
GTATCCCGGCGCGCCTCCTCCTCCTCCGCCTCCGCCTCCGCCTCCGCGGTCTGGCAATTCGCCCCGCCGCCTCCC
AGCAACCAGCCGCCGCCGCCTCCTCCCCCCGGCGCATAGGATGTCACCGAGGTTGGAAATCAGAGGCGCGCTAGC
CACAGACTCCCGGAACGAAAGAAGCGAGCATCTTACTCACAGTGATTTTTCTGCAGGGCAACATTGGCGGCTCGG
CTGGGAAGAAACGTGTGGATGATCCGAATTGGGAAGTCATCGTGCGAGTTTCACCGAATCACATGGACCGTCGGC
AACTGGAGCATTTATACCAAAAGTTGGTTGCCGCGGCGGCCAGGCTCGCATTGGACGCTGTGTACGGGGAGCGTG
CTTAGGACCTGGTTTTGGAGTCTTTACTCCTGACGGCGGTGGTGGTCTGATATGAGCGGACGAACAGGTACGAAG
GATGGTTTTGTGTTTGCCACGCTAATTGCACAGGCACTTTTTGTAGCCGGCCCTGTGGCTTTGCGCGTTGAGATG
GAAGGGCAATCTCGTGGTACTGAGGAGGTTCTGACCAGCCATCCGGGCTGGCAGTATTTGCGATTTGTACAAGTA
GCAGGGAATCGGTAGGGAAAGGGACAACAAAAAAAAAAACCGGCGATGTATGTATTCGTAGTTGGGCGTCGTTCG
AGACTCGCGATGCACGTGATGGAGGTTTGCGCAGGTTTGCGTGCCTCAGCATGGAGGCTCCACTAGTCTGGTGGA
TGGTAGTGCCGTTGGTGAAGACCGGGTTGTCTGAGGAGATACATGTGGGTAGATCTTATCGCAATGACGATGTCG
TAGGGCGGTTAAGGGGGGGTCGCCAGATGGTAGAGACATGAGGTACTCCTCACGCTTAGGCACACTATTCGTACG
CTAGTCCAGATTCAGCTGATTAGATAGGTAGGTACCTAGGTATCTGGGTAGGTCATGGCGCGGGCAGAACGTTCG
CGTCGTCGGTCCCCTCTCCTCTTCGCCTCGATCAGCTCCCTATATTCCGTACGGCTACATTTCTTCCTCCTACGA
CGGACTCCTCGCATAGAAGCCCGGCCGCATGACCCTCGAACGGTAACCTCCACTGTCCCGGCCGCCGTGAGGCAG
CATGAAGCTCGGTAATCCATTTGCCTTCGGGCCCGGCCCCGTCACCTTCTGGACGACGGCCGTCTACCTCGCCGT
CGTCATGCCGCTGATATACGTACACGAGACGGTCCCTCCCGCGCCGGCCGATGATGCTCTCGCCCGTGGCCTCAA
CCTGACGGAGGCATGGATGGACCTCCAGGCCATTACCAAGGCATACCATCCTTACGATAGCCGCGAGAATGATGG
CGTCCGTCGCTATCTTCTCCAACGTGTCTCGAAGATCCTGGACCGAAACGGCGTTGACTACACCCTCGAGCGTAG
CGCCAGTTCGAGCGGTGACTCGATGGGCGGATCCGCTGACGAGAGTTCGGGAGCTGCCATCTTCGACGACCGCGT
CTCCAACGTCACCTACACCTACCCGACTGCTTCAGGAGGAGCCGGCGAGTACTTTGAAGGCAGCAACGTATACGT
CTATATCCGCGGCAAGGAAGACCCCGCGGGCTACTGGTGGAGGCGAAAGCAATCGATGGATTTCTCGCGGCATAC
TGGAGGCGTGCTGGTCAACTGTCACTTGGACTCGGTCTCGGTCGGCTACGGCGCGACGGACGATGGTGTGGCTTG
CGTGTCAATGCTTCAGCTGCTGAGCTACTTTACGTCTGAAGGTCGTCAGCCCAAGTACGGCATCGTCCTGCTCTT
CAACAACGCCGAAGAGGACGGTCTTCTCGGGGCGCGAGCGTTTGGCGATAGCCCCTTGCTCGGCTTCTGCCGGAC
TTTTGTCAACCTCGAGGGCGCGGGCGCCGGCGGGCGTGCCATGCTCTTCCGGTCGACGGACCTCGAGACGGCCAA
GGCGTATTCCGGGAGTCCGCATCCGTTCGGGTCCGTGGTTGCGGCCAACGCTTTCGAGCAGGGAATCATCAAGAG
CGATACCGACTACTCCGTCTTTGCCGGGGTCTATGGCCAGCGAGGCATCGACATCGCCTTTTATCAGCCCAGGTC
GCGGTACCACACGATAGAGGACGACGCGCGCCACACGTCGACGGACAGCGTGTGGCACATGTTGTCGGCGGCTGT
GGCCTCGACCGAGACGCTTTCGGCCACGACGGGGACCGACTTTCAGGGCCCTCGCTCTGACGGGAGGAAGGACCT
CGCGCAGAATGGAAGGCCGACCGAGGGCGTCTGGTTCGACGTCTTTGGCAGCGCGTGGGCGGCATTTCCGCTTAG
GGGGCTGTTTGCCTGGTCCCTGACGCTGCTCGTGGCGACGCCGTTGATGCTCTTTCTCGTTTCTTACCTGCTGGC
TCGCAGCGACAAGTACTACTTCTTCGCCACCGAGGTCGAAGATGTCGAGGGCGAGCCCGTGGCGCTCAGGGGCTG
GAGGGGCTTCTTTCGCTATCCGCTTGCTCTGGTCTTTGCCGTCGGTTTGACGGTGGCTTCGGTGTTGCTGGTGGC
GAAGGTGAATCCGCTCATCATCCACAGCAGCAGCTACGCAGTGTAAGTGATGGATGGATGGCCTCTTTCTTTATC
TGAGAGAGACTAGGTGTTGAAAGTGGGAAGCTGACGAGGATCAACATACAGATGGGCCATGGTCATCTCGCTGTT
CTACCTTTCCTTCTGGCTCATCGCCCGCGGCGCCAGCTTCGTCCGGCCCAGCGCCCTGCAGCGAGGCTTCGCCCT
TCTGTGGCTGTACATCCTCTGCTGGGCCTTGCAGGTGGCGGCGGCCGTGGCCGAGGATCGGCTTCATATCGGAGC
CCTGTACTTTGCCGCCCTGTTGCACACGGCCGTCTTTGTGAGCCTGATGGTGTCTCTGCTCGAGCTGTTCGCGCT
GCCTTCCAAGCGCGACTTTGGGCTGGCACAGAGCATCGACGACGGCTCGAGTCGGCATTCGTCGGGGGAGCAGAG
CCGTCAGAGTCGGGGGGGGGAGGGGAACGAGGACGAGGACGAGGACGAGGACGAGGATGAGGACGAGGCTGACGA
GGCTACGGAGACGACGCCGCTGCGGGCTGGTGAAGCGGGCTACGGCTCGGGTGAGAACACGACGACGTTTGCTAG
CACCTACAGACGGTCTGTTGCCGCCGAGGCATCGTCGTCACCGTCTATCACTCGACCGCACGGTCCGGCTCCGTA
CCTGGGCGAGCAGGGCTGGTCAGGCCGTCTGCCCTCGTCGACGTGGCTTCTGCAGCTGCTGCTCCTAGCTCCGGT
CCATCTGATGACCCTCGGCAACCTCGGGCTCGTGCAGACGACGGCCATGGCCATGACGGGTCCGGATGGGAACAG
CGTCTCGATTCCTCTCCTAGCCGTCGCCGTGACCGCCATCCTCCTTCTCCTCCCCCTGACGCCCTTTTTGCACCG
GGTGACGCACCACGTCCCCCTATTCCTCCTCGCCGTCTTGGTCGGCACCCTCGCCTATAACCTATTCGCCTTTCC
CTTTTCCGCCGCCAGCAGGTTCAAGTTCCGCTTCCAGCAGATCGTCGATATCGACAACGGCACCAACACGGTGAT
TGTGACGGGTCTAGACCCCTTCGTCCGTCCCGTCGTCGCTGCGTTACCCTCGGCGGCGGGTCAGAGGATCGCCTG
TCCGGCCTCGACCATCAGTAACCTCGTCGACTGCCACTACGACGCGTCTTCCCTGCCGCCTCGACCCGTCAACGG
CACGAAGCTCGAGGACCTGGTGCGGGTGGAAGCTTCGAGGTCGGGCGACGGTCGCGGCGCGCGCCTCGAGATCCG
AGCTCGGGGGTCGAGGCTCTGCCACGTCGACCTCGAGAGGGCGGCGTTCGACTTTGGCGTCGAGGGCGGGGGGGG
AGGGATGCTCGCTTCGGCGTCTCGCCCGGGGAGGGATTCCGGAGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail