Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03038
Gene name
Locationscaffold_03:498632..501153
Strand-
Gene length (bp)2521
Transcript length (bp)2043
Coding sequence length (bp)2043
Protein length (aa) 681

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 516 535 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.01 0.00 0.08
Alive In ants, during behavior modification 116.51 53.67 179.35
Dead In ants, recently dead 112.68 49.82 175.53

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.241217 no
Alive Dead 0.903180 no
Dead Fungus 0.241217 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03038
MLDALFDPFFLQQIQLSLTGPRPTHSPMFPHQPLGSRAMDSAPASRGGTAASFSTPAACATEMLLNQASVADSGT
LISPPSSAAPPLSAWPPGHWDPHHFHQPSPDPFFAMGGGEVPPPYPPFSGPSSCSSSSAPAMVSEAARLSWSDGG
SPLTVYIQTQTPAQGSSSGPDEEDSDLPSIKMKKKEKSKKRYRSDEVKRSEQQQQQQQQQQSSTGQSTRWKKACL
RCRIQKLKCVPLDELNPSSDCAPCQMVSKTSKKTIHRIACHRGKLADVVLFRSGGLKLTERWDGTTMHDVGDRCS
PLEVRTIYVSNGCFGEPLQLQVVSFVSRPGDVTARFWYVREGPVGDEVEVRRKKEIDPYCLASIWKTADYFEKYV
VDNAIPAMARMTSPVKGCGRDLDEFKFIKRTFAMAIEYYHNLEDDFEDVTGMKRPNQEKRLLGNLFILWFAIRSA
HISGDEKLGMKAETKDETYPLFGKVSLPRMIVAQFDSINYTRILSRYGRLVLQDLESFVFRNQPRWWWTIYLCVF
ILLSGSTFVSADRYRHARHNHGFRYSIPGFVEDLQDGCNNMLMHWHYYNCKAWPDPNDPFSRHKTLLSELTSAQY
DLVMQTMSNERIQKELAIWQRYKDQNGALEPIDTQGRDPEPTPYMGSQTRFDWDHPLYWVSQMFEDRWNPHPTYQ
REYVA*
Coding >Ophcf2|03038
ATGCTCGACGCCCTCTTCGATCCCTTCTTTCTGCAACAGATTCAGCTGTCCCTGACCGGCCCTCGCCCTACCCAC
AGCCCCATGTTCCCGCATCAGCCTCTCGGCTCCAGGGCTATGGATTCGGCACCGGCTTCTCGAGGTGGCACAGCA
GCTTCATTCTCGACGCCGGCGGCTTGTGCGACGGAAATGTTGCTCAACCAGGCATCCGTCGCCGACTCAGGCACT
CTTATATCCCCCCCGTCTTCTGCTGCTCCGCCCCTTTCCGCCTGGCCACCGGGCCACTGGGACCCTCATCATTTC
CATCAGCCCTCCCCCGATCCCTTCTTTGCCATGGGAGGTGGTGAAGTTCCTCCTCCGTACCCGCCCTTTTCCGGT
CCGAGCAGCTGCTCATCCTCATCGGCGCCCGCCATGGTTTCCGAAGCTGCGAGGCTCTCTTGGTCGGACGGCGGT
TCCCCCCTTACCGTTTATATTCAGACTCAGACGCCGGCTCAGGGTAGCAGCTCAGGCCCTGACGAGGAGGATTCG
GACTTGCCGAGCATCAAGATGAAGAAGAAGGAGAAGTCCAAGAAGCGTTACCGGTCGGACGAGGTGAAGCGTAGT
GAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTCGTCGACGGGACAAAGCACGCGTTGGAAGAAGGCGTGTCTG
CGGTGTCGAATCCAGAAGCTCAAGTGCGTCCCCCTCGACGAGCTCAACCCATCCTCCGACTGCGCCCCCTGCCAA
ATGGTATCCAAGACCTCCAAGAAGACGATCCACCGCATCGCCTGCCACCGCGGCAAGCTCGCCGACGTCGTCCTC
TTCCGCTCCGGCGGCCTCAAGCTGACGGAACGCTGGGACGGAACGACGATGCACGACGTAGGAGACCGCTGCTCT
CCCCTAGAGGTGCGCACCATATACGTCTCCAACGGCTGCTTCGGCGAGCCGCTTCAGCTGCAGGTCGTGTCGTTT
GTCTCGCGGCCGGGAGACGTCACCGCTCGCTTTTGGTATGTTCGGGAGGGGCCGGTCGGGGATGAGGTCGAGGTG
AGGCGCAAGAAGGAGATCGATCCGTATTGTCTCGCCAGCATCTGGAAGACGGCGGACTACTTTGAGAAGTATGTT
GTTGACAATGCTATTCCTGCCATGGCGAGGATGACTTCACCCGTCAAGGGGTGTGGGCGGGATCTGGATGAGTTC
AAGTTCATCAAGCGGACATTTGCCATGGCCATTGAGTATTATCACAACCTCGAGGACGACTTCGAAGACGTCACT
GGCATGAAGAGACCAAACCAGGAGAAGAGGCTACTCGGAAACCTCTTTATCCTATGGTTTGCCATCCGCAGCGCC
CACATCAGCGGCGACGAAAAGCTCGGCATGAAGGCCGAAACCAAAGACGAAACATACCCCCTCTTCGGCAAGGTC
TCCCTTCCACGTATGATCGTAGCCCAATTCGACAGCATCAACTACACGCGTATCCTCAGTCGATACGGCCGCTTG
GTGCTTCAGGATCTCGAATCCTTCGTCTTCCGCAATCAGCCTCGCTGGTGGTGGACCATCTATCTCTGCGTCTTC
ATCCTGCTCAGCGGATCGACTTTTGTGAGCGCAGATAGGTATCGGCACGCGAGGCATAACCATGGGTTCCGATAC
TCTATCCCCGGCTTCGTCGAGGATCTTCAAGACGGCTGTAACAACATGCTCATGCACTGGCATTACTACAACTGC
AAGGCCTGGCCCGACCCGAACGACCCCTTCAGCCGACACAAAACCCTCCTGTCCGAACTGACCTCCGCCCAATAC
GACCTCGTCATGCAAACCATGTCCAACGAACGCATCCAGAAAGAACTAGCCATCTGGCAGCGATACAAAGACCAG
AACGGCGCTCTTGAGCCCATCGATACACAGGGCCGCGACCCCGAACCAACGCCGTACATGGGCTCGCAGACGCGA
TTCGACTGGGATCATCCGCTGTATTGGGTGTCGCAGATGTTTGAGGACCGGTGGAATCCGCATCCAACGTATCAG
CGGGAGTACGTGGCGTAG
Transcript >Ophcf2|03038
ATGCTCGACGCCCTCTTCGATCCCTTCTTTCTGCAACAGATTCAGCTGTCCCTGACCGGCCCTCGCCCTACCCAC
AGCCCCATGTTCCCGCATCAGCCTCTCGGCTCCAGGGCTATGGATTCGGCACCGGCTTCTCGAGGTGGCACAGCA
GCTTCATTCTCGACGCCGGCGGCTTGTGCGACGGAAATGTTGCTCAACCAGGCATCCGTCGCCGACTCAGGCACT
CTTATATCCCCCCCGTCTTCTGCTGCTCCGCCCCTTTCCGCCTGGCCACCGGGCCACTGGGACCCTCATCATTTC
CATCAGCCCTCCCCCGATCCCTTCTTTGCCATGGGAGGTGGTGAAGTTCCTCCTCCGTACCCGCCCTTTTCCGGT
CCGAGCAGCTGCTCATCCTCATCGGCGCCCGCCATGGTTTCCGAAGCTGCGAGGCTCTCTTGGTCGGACGGCGGT
TCCCCCCTTACCGTTTATATTCAGACTCAGACGCCGGCTCAGGGTAGCAGCTCAGGCCCTGACGAGGAGGATTCG
GACTTGCCGAGCATCAAGATGAAGAAGAAGGAGAAGTCCAAGAAGCGTTACCGGTCGGACGAGGTGAAGCGTAGT
GAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTCGTCGACGGGACAAAGCACGCGTTGGAAGAAGGCGTGTCTG
CGGTGTCGAATCCAGAAGCTCAAGTGCGTCCCCCTCGACGAGCTCAACCCATCCTCCGACTGCGCCCCCTGCCAA
ATGGTATCCAAGACCTCCAAGAAGACGATCCACCGCATCGCCTGCCACCGCGGCAAGCTCGCCGACGTCGTCCTC
TTCCGCTCCGGCGGCCTCAAGCTGACGGAACGCTGGGACGGAACGACGATGCACGACGTAGGAGACCGCTGCTCT
CCCCTAGAGGTGCGCACCATATACGTCTCCAACGGCTGCTTCGGCGAGCCGCTTCAGCTGCAGGTCGTGTCGTTT
GTCTCGCGGCCGGGAGACGTCACCGCTCGCTTTTGGTATGTTCGGGAGGGGCCGGTCGGGGATGAGGTCGAGGTG
AGGCGCAAGAAGGAGATCGATCCGTATTGTCTCGCCAGCATCTGGAAGACGGCGGACTACTTTGAGAAGTATGTT
GTTGACAATGCTATTCCTGCCATGGCGAGGATGACTTCACCCGTCAAGGGGTGTGGGCGGGATCTGGATGAGTTC
AAGTTCATCAAGCGGACATTTGCCATGGCCATTGAGTATTATCACAACCTCGAGGACGACTTCGAAGACGTCACT
GGCATGAAGAGACCAAACCAGGAGAAGAGGCTACTCGGAAACCTCTTTATCCTATGGTTTGCCATCCGCAGCGCC
CACATCAGCGGCGACGAAAAGCTCGGCATGAAGGCCGAAACCAAAGACGAAACATACCCCCTCTTCGGCAAGGTC
TCCCTTCCACGTATGATCGTAGCCCAATTCGACAGCATCAACTACACGCGTATCCTCAGTCGATACGGCCGCTTG
GTGCTTCAGGATCTCGAATCCTTCGTCTTCCGCAATCAGCCTCGCTGGTGGTGGACCATCTATCTCTGCGTCTTC
ATCCTGCTCAGCGGATCGACTTTTGTGAGCGCAGATAGGTATCGGCACGCGAGGCATAACCATGGGTTCCGATAC
TCTATCCCCGGCTTCGTCGAGGATCTTCAAGACGGCTGTAACAACATGCTCATGCACTGGCATTACTACAACTGC
AAGGCCTGGCCCGACCCGAACGACCCCTTCAGCCGACACAAAACCCTCCTGTCCGAACTGACCTCCGCCCAATAC
GACCTCGTCATGCAAACCATGTCCAACGAACGCATCCAGAAAGAACTAGCCATCTGGCAGCGATACAAAGACCAG
AACGGCGCTCTTGAGCCCATCGATACACAGGGCCGCGACCCCGAACCAACGCCGTACATGGGCTCGCAGACGCGA
TTCGACTGGGATCATCCGCTGTATTGGGTGTCGCAGATGTTTGAGGACCGGTGGAATCCGCATCCAACGTATCAG
CGGGAGTACGTGGCGTAG
Gene >Ophcf2|03038
ATGCTCGACGCCCTCTTCGATCCCTTCTTTCTGCAACAGATTCAGCTGTCCCTGACCGGCCCTCGCCCTACCCAC
AGCCCCATGTTCCCGCATCAGCCTCTCGGCTCCAGGGCTATGGATTCGGCACCGGCTTCTCGAGGTGGCACAGCA
GCTTCATTCTCGACGCCGGCGGCTTGTGCGACGGAAATGTTGCTCAACCAGGCATCCGTCGCCGACTCAGGCACT
CTTATATCCCCCCCGTCTTCTGCTGCTCCGCCCCTTTCCGCCTGGCCACCGGGCCACTGGGACCCTCATCATTTC
CATCAGCCCTCCCCCGATCCCTTCTTTGCCATGGGAGGTGGTGAAGTTCCTCCTCCGTACCCGCCCTTTTCCGGT
CCGAGCAGCTGCTCATCCTCATCGGCGCCCGCCATGGTTTCCGAAGCTGCGAGGCTCTCTTGGTCGGACGGCGGT
TCCCCCCTTACCGTTTATATTCAGACTCAGACGCCGGCTCAGGGTAGCAGCTCAGGCCCTGACGAGGAGGATTCG
GACTTGCCGAGCATCAAGATGAAGAAGAAGGAGAAGTCCAAGAAGCGTTACCGGTCGGACGAGGTGAAGCGTAGT
GAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTCGTCGACGGGACAAAGCACGCGTTGGAAGAAGGCGTGTCTG
CGGTGTCGAATCCAGAAGCTCAAGGTCAGTCGTGTCTTGGGTTGCTCGACGAGTTGATTCTCTTGTTCGACTCTT
TACCTCTTCTTCCCTTGTTCTCTTACCAGCTCTTTCTCCTCATCAACCTCGCATATGTATTTCCATAACATGTGT
ATTTCTATAATCCCCTTCTTCTCCCAAACTCTCCCCTCAAAACTCCTCTTCTCCAACCCTCTCCTCCTAACTCTC
CCGCAGTGCGTCCCCCTCGACGAGCTCAACCCATCCTCCGACTGCGCCCCCTGCCAAATGGTATCCAAGACCTCC
AAGAAGACGATCCACCGCATCGCCTGCCACCGCGGCAAGCTCGCCGACGTCGTCCTCTTCCGCTCCGGCGGCCTC
AAGCTGACGGAACGCTGGGACGGAACGACGATGCACGACGTAGGAGACCGCTGCTCTCCCCTAGAGGTGCGCACC
ATATACGTCTCCAACGGCTGCTTCGGCGAGCCGCTTCAGCTGCAGGTCGTGTCGTTTGTCTCGCGGCCGGGAGAC
GTCACCGCTCGCTTTTGGTATGTTCGGGAGGGGCCGGTCGGGGATGAGGTCGAGGTGAGGCGCAAGAAGGAGATC
GATCCGTATTGTCTCGCCAGCATCTGGAAGACGGCGGACTACTTTGAGAAGTATGTTGTTGACAATGCTATTCCT
GCCATGGCGAGGATGACTTCACCCGTCAAGGGGTGTGGGCGGGATCTGGATGAGTTCAAGTTCATCAAGCGGACA
TTTGCCATGGCCATTGAGTATTATCACAACCTCGAGGTATGTTGTGTCGGGTTTTGTCGTTGGTTTACGGCTGAC
GTTGATGTCTGCTTCAAGGACGACTTCGAAGACGTCACTGGCATGAAGAGACCAAACCAGGAGAAGAGGCTACTC
GGAAACCTCTTTATCCTATGGTTTGCCATCCGTAAGTCACGTCCCCCCTCTCATCCCTCTTCCAGGTCCGGCCGT
CCCTTTCCCTCTCTCAAACTCGGCGCTGAGAAAGAGAAAAGGCAACTCGACAGGCAGCGCCCACATCAGCGGCGA
CGAAAAGCTCGGCATGAAGGCCGAAACCAAAGACGAAACATACCCCCTCTTCGGCAAGGTCTCCCTTCCACGTAT
GATCGTAGCCCAATTCGACAGCATCAACTACACGCGTATCCTCAGTCGATACGGCCGCTTGGTGCTTCAGGATCT
CGAATCCTTCGTCTTCCGCAATCAGCCTCGCTGGTGGTGGACCATCTATCTCTGCGTCTTCATCCTGCTCAGCGG
ATCGACTTTTGTGAGCGCAGATAGGTATCGGCACGCGAGGCATAACCATGGGGTAAAGGTCAGGCGATTGAATCC
CCAGTGAGAACAGAGAATGAGAGGCTGACGCCGGACAGTTCCGATACTCTATCCCCGGCTTCGTCGAGGATCTTC
AAGACGGCTGTAACAACATGCTCATGCACTGGCATTACTACAACTGCAAGGCCTGGCCCGACCCGAACGACCCCT
TCAGCCGACACAAAACCCTCCTGTCCGAACTGACCTCCGCCCAATACGACCTCGTCATGCAAACCATGTCCAACG
AACGCATCCAGAAAGAACTAGCCATCTGGCAGCGATACAAAGACCAGAACGGCGCTCGTACGTCGCCTTTCACTC
CCCTCTTCGAAACCCGGCTGACGAAGGCTCGCTTCCAGTTGAGCCCATCGATACACAGGGCCGCGACCCCGAACC
AACGCCGTACATGGGCTCGCAGACGCGATTCGACTGGGATCATCCGCTGTATTGGGTGTCGCAGATGTTTGAGGA
CCGGTGGAATCCGCATCCAACGTATCAGCGGGAGTACGTGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail