Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03033
Gene name
Locationscaffold_03:480666..482379
Strand+
Gene length (bp)1713
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4582 0.4744 0.1773 0.0613 0.3787 0.0158 0.1575 0.156 0.0709 0.0068

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2421
Ophiocordyceps australis 1348a (Ghana) OphauG2|882
Ophiocordyceps australis map64 (Brazil) OphauB2|3723
Ophiocordyceps camponoti-floridani Ophcf2|03033 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7238
Ophiocordyceps kimflemingae Ophio5|823
Ophiocordyceps subramaniannii Hirsu2|158

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03033
MKEQTSPLERLSTEILTLIIDHVRSLHHPSVFTLRLACRGLDSLATPVAYRSIHLNEAILSPSAESRLSLVRFVK
TSVGKEKTKRFPNFLMTALLTLTDLTNRRPWQRITINVGGWRRSMIRRTGYAWKRHNERGVYAERCFWLEADGRG
GGYTVGEEEALRGGGLCAARDSFGRLRAG*
Coding >Ophcf2|03033
ATGAAGGAACAGACAAGTCCGTTAGAAAGACTATCAACCGAAATCCTAACCCTCATAATCGACCACGTCCGATCC
CTCCACCACCCCTCCGTCTTCACCCTCCGTCTCGCCTGTCGCGGCCTGGACTCGCTCGCCACGCCGGTAGCCTAC
CGGTCGATCCACCTCAACGAAGCCATCCTCTCCCCCTCGGCTGAAAGTCGTCTATCGCTCGTCAGGTTCGTCAAG
ACATCCGTAGGAAAGGAGAAAACAAAAAGGTTTCCCAACTTCCTAATGACCGCCCTCCTGACCTTGACCGACCTC
ACCAACCGCCGACCCTGGCAGCGGATAACCATCAACGTCGGCGGCTGGCGACGCTCCATGATCCGCCGCACGGGC
TACGCGTGGAAGCGGCACAACGAGCGGGGCGTCTACGCCGAGCGCTGCTTCTGGCTCGAGGCCGATGGTCGGGGG
GGGGGGTATACCGTCGGCGAGGAGGAGGCTTTGAGGGGGGGGGGGCTCTGTGCGGCTAGGGATAGCTTCGGTCGG
CTCCGGGCCGGGTAG
Transcript >Ophcf2|03033
ATGAAGGAACAGACAAGTCCGTTAGAAAGACTATCAACCGAAATCCTAACCCTCATAATCGACCACGTCCGATCC
CTCCACCACCCCTCCGTCTTCACCCTCCGTCTCGCCTGTCGCGGCCTGGACTCGCTCGCCACGCCGGTAGCCTAC
CGGTCGATCCACCTCAACGAAGCCATCCTCTCCCCCTCGGCTGAAAGTCGTCTATCGCTCGTCAGGTTCGTCAAG
ACATCCGTAGGAAAGGAGAAAACAAAAAGGTTTCCCAACTTCCTAATGACCGCCCTCCTGACCTTGACCGACCTC
ACCAACCGCCGACCCTGGCAGCGGATAACCATCAACGTCGGCGGCTGGCGACGCTCCATGATCCGCCGCACGGGC
TACGCGTGGAAGCGGCACAACGAGCGGGGCGTCTACGCCGAGCGCTGCTTCTGGCTCGAGGCCGATGGTCGGGGG
GGGGGGTATACCGTCGGCGAGGAGGAGGCTTTGAGGGGGGGGGGGCTCTGTGCGGCTAGGGATAGCTTCGGTCGG
CTCCGGGCCGGGTAG
Gene >Ophcf2|03033
ATGAAGGAACAGACAAGTCCGTTAGAAAGACTATCAACCGAAATCCTAACCCTCATAATCGACCACGTCCGATCC
CTCCACCACCCCTCCGTCTTCACCCTCCGTCTCGCCTGTCGCGGCCTGGACTCGCTCGCCACGCCGGTAGCCTAC
CGGTCGATCCACCTCAACGAAGCCATCCTCTCCCCCTCGGCTGAAAGTCGTCTATCGCTCGTCAGGTTCGTCAAG
ACATCCGTAGGAAAGGAGAAAACAAAAAGGTTTCCCAACTTCCTAATGAGTCGGTCAAGATGGTGCTACGTCCGC
CAAAACCCCATCGACACTTCCGCCCTCCGACTCCCATGGCACGTCCTGGACACCGGGGCAACTCCGACGCAGCAA
CACGAGCATCCAAGTCGAGAATCTCCCACTGGGAGGTTCAAAACTGCGACGTCGAGGAATCATTCTTCACCCCGG
CCCTAACCAACCGCCTGACCTCCCTCAAGCTCTCCAGCCCGAAACCACGACTCACGAACACGAACGGCCTCTCTC
AAACGCCTCCTACTGCAATCGCCGCATCTCCGGGTCCTACACTACCGCGATCTCGGTATGGGTACCAGCTTCGCC
TTCACCGGCGAGGAACGACTGCCCCCCATCCGAGATCTGGTCCTCCATATCGTATAACTGGGGAGCACTCGGCCG
AACAGGTCCATCGACACTGGGACTTCTCGCAGATGCGCTCGCTGGAGCTCGTCAACATGCCCGGTAGCAAACTTG
CTCTCTTCCATCCGTCCTCGAGATTTCCCGCGGCTTCACACCCTCCGCGTCGAAAGATTACGGAGGCCACCTCCA
AGATTCACAGCCCGTAGCCAACACTCCGTCTTTGCGACCTCGTACGGAATCACATCCGAGCCCTCGAAACGCTAG
ACATCACCTGCCACACCCGGCTCTTCGAACTGTCGGCCCTCGACCGCCACAGAGACTCCCTCCGCGTCCTCCGCT
ACCGTGACCACATCGGCTTCGAAGACGACAGCAAGGAATGTCCCACGCTCAGCCGAAGCGAGCTATCAGCACTAG
GCCGACGACTCACAAACGTCTCCACACCCTGGAACTAGACACCGAACGCCCAACACCAACAAATCCATCGAGAGC
GTCACCTCCTTCCCCCATCTCGCCACCCTAACCCTCCACGTGCAAACGCGAATCCGAGCCTCCGAAGCCATAAAA
CCAAAGCCATGACCCGGACCGCTCAGCCGCCCTCCTGACCTTGACCGACCTCACCAACCGCCGACCCTGGCAGCG
GATAACCATCAACGTCGGCGGCTGGCGACGCTCCATGATCCGCCGCACGGGCTACGCGTGGAAGCGGCACAACGA
GCGGGGCGTCTACGCCGAGCGCTGCTTCTGGCTCGAGGCCGATGGTCGGGGGGGGGGGTATACCGTCGGCGAGGA
GGAGGCTTTGAGGGGGGGGGGGCTCTGTGTAGGCCTTCGCGGGTTTTACGCTTGGGGGGTGGGTAAGGGGGTTAG
GTGGTGTAGTGGGTTTGGATGGATCCGCTATCATGGACTGGTATGTATGTGAGTTGAGGAGGGATGACGGAGGGG
ATGACGGGAGGTTTTTTTTTTCGATTCCAAGGGGGAAGGGGGGTTGGTTGAGGCTGGATGGTTGTGAGGCAACCA
TTTGCGCGCTTTTCGTGACGCTAGGCGGCTAGGGATAGCTTCGGTCGGCTCCGGGCCGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail