Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03031
Gene name
Locationscaffold_03:475572..477180
Strand+
Gene length (bp)1608
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14555 UBA_4 UBA-like domain 1.1E-12 13 53
PF00789 UBX UBX domain 1.4E-07 398 492

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.3683 0.594 0.0376 0.0388 0.3714 0.0062 0.4883 0.0859 0.2032 0.0724

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5064
Ophiocordyceps australis map64 (Brazil) OphauB2|2100
Ophiocordyceps camponoti-floridani Ophcf2|03031 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|316
Ophiocordyceps kimflemingae Ophio5|6133
Ophiocordyceps subramaniannii Hirsu2|2076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03031
MANGDGQLSPSQQQALQQYVQVTNQDADAARSLLQRSQWNVEIAVAKFFDGEGPDLVAEAMAAQRAPPRHENLQE
SLLEAAAASGSRRTRRDRTDPAPRIVPPQPVTHRTPWLLGLLLAPFSWGCRATSALVRTCYYLFSFLPAAIRPRA
VTAGLTSSRGRRMLLPRDTAARFKREFDEEYGPNELPFFEGGLAQAHDLAKKDVKFLLMLLMSPEHDDTASFVRE
TLLSADVVGFIGNPANGIILWGGNVLDSEAYQAATEYNCTKFPFSALVCLTPKEGSARMGVVKRVTGPVPAGAYL
SELQGAMEKYGADLESVRAERTAQEVARTLRTEQDSAYERSLAIDRERAREKREAAAAAAEADRRAREEAEAAAA
KEQKRRQWRAWRASRVGPEPAAEEKKVVRIALKMPEASGAGRIVRRFAHDSSLEELYAFVDCYDVRPDGAAEPPP
DMYEHEYEFRIVSTLPRVVYEPSMTMTLGESIGKSGNLIVEETRGEEEMKEEQEEEEEEKGEKGQQSR*
Coding >Ophcf2|03031
ATGGCCAACGGCGACGGCCAACTGTCCCCCAGCCAGCAGCAGGCTCTTCAGCAATACGTTCAGGTCACCAATCAA
GACGCAGACGCCGCCCGCTCGCTGCTTCAGCGGTCTCAATGGAACGTCGAGATCGCCGTGGCCAAGTTCTTCGAT
GGCGAAGGTCCCGATCTGGTGGCCGAGGCCATGGCCGCCCAGCGCGCGCCGCCGCGACACGAGAATCTTCAAGAG
AGCCTTCTCGAAGCTGCCGCAGCCTCTGGCTCGAGACGAACGCGCAGAGATCGCACCGATCCGGCCCCCCGGATC
GTGCCGCCGCAGCCCGTCACGCACCGCACGCCCTGGCTGCTCGGTCTGCTGTTGGCGCCCTTTAGCTGGGGCTGT
CGAGCGACGTCGGCCCTCGTACGCACATGCTACTACCTCTTCTCCTTTCTACCCGCCGCCATACGACCACGCGCC
GTCACGGCCGGCTTGACCAGTTCAAGGGGCCGGCGCATGCTGCTCCCCCGCGATACAGCCGCCAGGTTCAAGCGC
GAGTTTGACGAGGAGTACGGGCCCAACGAGCTACCATTCTTCGAGGGCGGGCTGGCACAGGCGCATGATTTGGCC
AAAAAGGACGTCAAGTTTTTGCTGATGCTTCTCATGTCACCGGAGCACGACGACACGGCCTCGTTTGTGCGCGAG
ACGCTGCTGAGCGCCGACGTGGTCGGTTTCATCGGAAACCCGGCCAACGGCATCATCCTCTGGGGCGGCAACGTC
CTCGACTCGGAAGCCTACCAGGCGGCGACCGAGTACAACTGTACCAAGTTTCCCTTTTCGGCCCTCGTGTGCCTG
ACCCCCAAGGAGGGCAGCGCTCGGATGGGCGTCGTCAAGCGGGTGACCGGCCCCGTGCCGGCGGGCGCCTACCTG
TCGGAGCTGCAGGGCGCCATGGAAAAGTACGGTGCCGATCTGGAGAGCGTGAGGGCAGAGCGGACAGCGCAAGAG
GTGGCTCGCACGCTGCGCACCGAGCAGGATTCGGCATACGAGCGGTCACTGGCCATCGATCGCGAGCGGGCGCGC
GAGAAGAGAGAGGCGGCGGCTGCTGCTGCCGAGGCAGACAGGAGGGCGCGCGAGGAGGCCGAAGCGGCGGCGGCG
AAAGAGCAGAAGCGACGGCAGTGGAGGGCGTGGAGGGCATCCCGGGTCGGGCCAGAGCCAGCGGCCGAGGAGAAG
AAGGTGGTGAGGATTGCGCTCAAGATGCCGGAAGCCTCGGGCGCAGGACGAATCGTGAGGCGGTTCGCGCACGAC
TCGTCTTTGGAGGAGCTCTACGCCTTTGTCGACTGCTACGACGTGAGACCGGACGGGGCAGCGGAGCCGCCGCCA
GACATGTACGAGCACGAATACGAGTTCCGAATCGTGTCGACTCTGCCACGAGTGGTTTACGAGCCGAGCATGACG
ATGACGCTGGGGGAGAGCATCGGCAAGTCAGGGAACCTGATTGTGGAGGAGACGAGGGGTGAGGAGGAGATGAAG
GAGGAACAGGAGGAGGAGGAGGAGGAGAAGGGAGAAAAGGGGCAACAGTCGAGGTAG
Transcript >Ophcf2|03031
ATGGCCAACGGCGACGGCCAACTGTCCCCCAGCCAGCAGCAGGCTCTTCAGCAATACGTTCAGGTCACCAATCAA
GACGCAGACGCCGCCCGCTCGCTGCTTCAGCGGTCTCAATGGAACGTCGAGATCGCCGTGGCCAAGTTCTTCGAT
GGCGAAGGTCCCGATCTGGTGGCCGAGGCCATGGCCGCCCAGCGCGCGCCGCCGCGACACGAGAATCTTCAAGAG
AGCCTTCTCGAAGCTGCCGCAGCCTCTGGCTCGAGACGAACGCGCAGAGATCGCACCGATCCGGCCCCCCGGATC
GTGCCGCCGCAGCCCGTCACGCACCGCACGCCCTGGCTGCTCGGTCTGCTGTTGGCGCCCTTTAGCTGGGGCTGT
CGAGCGACGTCGGCCCTCGTACGCACATGCTACTACCTCTTCTCCTTTCTACCCGCCGCCATACGACCACGCGCC
GTCACGGCCGGCTTGACCAGTTCAAGGGGCCGGCGCATGCTGCTCCCCCGCGATACAGCCGCCAGGTTCAAGCGC
GAGTTTGACGAGGAGTACGGGCCCAACGAGCTACCATTCTTCGAGGGCGGGCTGGCACAGGCGCATGATTTGGCC
AAAAAGGACGTCAAGTTTTTGCTGATGCTTCTCATGTCACCGGAGCACGACGACACGGCCTCGTTTGTGCGCGAG
ACGCTGCTGAGCGCCGACGTGGTCGGTTTCATCGGAAACCCGGCCAACGGCATCATCCTCTGGGGCGGCAACGTC
CTCGACTCGGAAGCCTACCAGGCGGCGACCGAGTACAACTGTACCAAGTTTCCCTTTTCGGCCCTCGTGTGCCTG
ACCCCCAAGGAGGGCAGCGCTCGGATGGGCGTCGTCAAGCGGGTGACCGGCCCCGTGCCGGCGGGCGCCTACCTG
TCGGAGCTGCAGGGCGCCATGGAAAAGTACGGTGCCGATCTGGAGAGCGTGAGGGCAGAGCGGACAGCGCAAGAG
GTGGCTCGCACGCTGCGCACCGAGCAGGATTCGGCATACGAGCGGTCACTGGCCATCGATCGCGAGCGGGCGCGC
GAGAAGAGAGAGGCGGCGGCTGCTGCTGCCGAGGCAGACAGGAGGGCGCGCGAGGAGGCCGAAGCGGCGGCGGCG
AAAGAGCAGAAGCGACGGCAGTGGAGGGCGTGGAGGGCATCCCGGGTCGGGCCAGAGCCAGCGGCCGAGGAGAAG
AAGGTGGTGAGGATTGCGCTCAAGATGCCGGAAGCCTCGGGCGCAGGACGAATCGTGAGGCGGTTCGCGCACGAC
TCGTCTTTGGAGGAGCTCTACGCCTTTGTCGACTGCTACGACGTGAGACCGGACGGGGCAGCGGAGCCGCCGCCA
GACATGTACGAGCACGAATACGAGTTCCGAATCGTGTCGACTCTGCCACGAGTGGTTTACGAGCCGAGCATGACG
ATGACGCTGGGGGAGAGCATCGGCAAGTCAGGGAACCTGATTGTGGAGGAGACGAGGGGTGAGGAGGAGATGAAG
GAGGAACAGGAGGAGGAGGAGGAGGAGAAGGGAGAAAAGGGGCAACAGTCGAGGTAG
Gene >Ophcf2|03031
ATGGCCAACGGCGACGGCCAACTGTCCCCCAGCCAGCAGCAGGCTCTTCAGCAATACGTTCAGGTCACCAATCAA
GACGCAGACGCCGCCCGCTCGCTGCTTCAGCGGTCTCAATGGAACGTCGAGGTAGGGTCTGACCTTGTCGATGAT
CCGGCTGCCTGTGGCTGAGTCTTCCAGATCGCCGTGGCCAAGTTCTTCGATGGCGAAGGTCCCGATCTGGTGGCC
GAGGCCATGGCCGCCCAGCGCGCGCCGCCGCGACACGAGAATCTTCAAGAGAGCCTTCTCGAAGCTGCCGCAGCC
TCTGGCTCGAGACGAACGCGCAGAGATCGCACCGATCCGGCCCCCCGGATCGTGCCGCCGCAGCCCGTCACGCAC
CGCACGCCCTGGCTGCTCGGTCTGCTGTTGGCGCCCTTTAGCTGGGGCTGTCGAGCGACGTCGGCCCTCGTACGC
ACATGCTACTACCTCTTCTCCTTTCTACCCGCCGCCATACGACCACGCGCCGTCACGGCCGGCTTGACCAGTTCA
AGGGGCCGGCGCATGCTGCTCCCCCGCGATACAGCCGCCAGGTTCAAGCGCGAGTTTGACGAGGAGTACGGGCCC
AACGAGCTACCATTCTTCGAGGGCGGGCTGGCACAGGCGCATGATTTGGCCAAAAAGGACGTCAAGTTTTTGCTG
ATGCTTCTCATGTCACCGGAGCACGACGACACGGCCTCGTTTGTGCGCGAGACGCTGCTGAGCGCCGACGTGGTC
GGTTTCATCGGAAACCCGGCCAACGGCATCATCCTCTGGGGCGGCAACGTCCTCGACTCGGAAGCCTACCAGGCG
GCGACCGAGTACAACTGTACCAAGTTTCCCTTTTCGGCCCTCGTGTGCCTGACCCCCAAGGAGGGCAGCGCTCGG
ATGGGCGTCGTCAAGCGGGTGACCGGCCCCGTGCCGGCGGGCGCCTACCTGTCGGAGCTGCAGGGCGCCATGGAA
AAGTACGGTGCCGATCTGGAGAGCGTGAGGGCAGAGCGGACAGCGCAAGAGGTGGCTCGCACGCTGCGCACCGAG
CAGGATTCGGCATACGAGCGGTCACTGGCCATCGATCGCGAGCGGGCGCGCGAGAAGAGAGAGGCGGCGGCTGCT
GCTGCCGAGGCAGACAGGAGGGCGCGCGAGGAGGCCGAAGCGGCGGCGGCGAAAGAGCAGAAGCGACGGCAGTGG
AGGGCGTGGAGGGCATCCCGGGTCGGGCCAGAGCCAGCGGCCGAGGAGAAGAAGGTGGTGAGGATTGCGCTCAAG
ATGCCGGAAGCCTCGGGCGCAGGACGAATCGTGAGGCGGTTCGCGCACGACTCGTCTTTGGAGGAGCTCTACGCC
TTTGTCGACTGCTACGACGTGAGACCGGACGGGGCAGCGGAGCCGCCGCCAGACATGTACGAGCACGAATACGAG
TTCCGAATCGTGTCGACTCTGCCACGAGTGGTTTACGAGCCGAGCATGACGATGACGCTGGGGGAGAGCATCGGC
AAGTCAGGGAACCTGATTGTGGAGGAGACGAGGGGTGAGGAGGAGATGAAGGAGGAACAGGAGGAGGAGGAGGAG
GAGAAGGGAGAAAAGGGGCAACAGTCGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail