Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03030
Gene name
Locationscaffold_03:471605..474724
Strand-
Gene length (bp)3119
Transcript length (bp)2829
Coding sequence length (bp)2829
Protein length (aa) 943

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18101 Pan3_PK Pan3 Pseudokinase domain 1.9E-61 499 635

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6976 0.3105 0.2039 0.2074 0.0766 0.0063 0.0712 0.0637 0.1305 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2765
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5065
Ophiocordyceps australis map64 (Brazil) OphauB2|2099
Ophiocordyceps camponoti-floridani Ophcf2|03030 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6371
Ophiocordyceps kimflemingae Ophio5|6132
Ophiocordyceps subramaniannii Hirsu2|4402

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03030
MATSRFPSSDLRRQLGSPRPKARENKETLCRNVLIYGHCRYEEQGCSFSHDPNRNNANSTSNNGGPDGSKKALNV
ESPSFTPASILPPALKKATIPTQAASAPAFTPRAMSGTPVTAPAEVDAAVFNPAAIREFTPGLDVSSQPPNGSNQ
DPFDAFAMAAVGQNLPQAPFNPYAEDHNAMAGSSSFFPPQGAFNTPLQPLQHHLYAPWGPRREDLMPYHRMAHEF
FMPEKLRQEMQKKAEATLQVIPNSQLPQLDNYHSLVALDTTHRKNPSIFGYPSWVYKATSIKTGHVYLLRRLEGF
RLTNEHAIRSVKEWRKVDNANVVTVHDAFTARAFGDSSLIFVQDYFPLSKTLAEVHFAVGSGPSNRYQPKGPIAE
PALWSYIAQIANALKAIHAANLAARCVDASKIILTDKNRVRLNACAVLDVVQYEMRRPLRELQQDDLVQFGRTML
CLATSTPSALMTNLNASVEQMSRTYSAELRDTIVWLLTPQQPPAVKSMDEFIRGVAGHIVTAFEESQHSNDQLNA
ELFRELENGRIARLLMKLGTVNERYEFDGDRAWSENGERYMLKLFRDYVFHQVDGSGNPVVDVGHMVRCLNRLDA
GTEERVCLTSRDEQTSFLVSYKELKKQLGNAFGELQKGSAGGAGKQQGRGSSRTPAAGGVIAREGSRGKGSGRRG
GPHPGHCPAPMPSQLERGQFLDSNDGGEKGVKPLGAAGGGRSRSEGQSGPEAGALKQEETGDGPLKGGKSSHAGI
KFRPDAAEFVPGMKLRVTDEGGQEERVEDGLLPTVPPKGPAKKPHTGSLPGHAKEPDIEPPKGLAKRSLPKGLPM
KPPSGRPTRLPPGRADEPHRQPQSGPPIGHFGPLNPFMGPFDGPLMGPPMGPPMVPPTGPPMGLPVMPDGRLGGH
STGGAGSGPHGAATGGPHIPRHDYDPRMGGQPPPQGALERHW*
Coding >Ophcf2|03030
ATGGCGACCTCGCGTTTCCCCTCGAGCGATCTTCGCCGTCAGCTCGGTTCTCCGAGGCCCAAGGCACGAGAAAAC
AAGGAAACGCTATGCAGAAATGTCCTCATCTACGGCCACTGCCGCTATGAAGAACAGGGCTGTTCTTTTTCTCAT
GACCCCAATAGAAATAATGCAAACAGCACCAGTAATAATGGAGGCCCGGACGGGTCCAAGAAGGCGCTCAACGTC
GAATCGCCCTCCTTCACCCCGGCCAGTATTCTTCCTCCCGCCCTCAAAAAGGCCACCATTCCAACCCAGGCCGCG
AGCGCTCCGGCCTTCACTCCACGAGCCATGAGCGGCACTCCCGTCACGGCTCCGGCAGAAGTCGATGCCGCCGTC
TTCAACCCAGCTGCTATACGCGAGTTCACTCCAGGTCTCGACGTCAGCTCTCAGCCGCCCAACGGCTCGAACCAA
GATCCCTTTGATGCCTTTGCCATGGCCGCCGTCGGCCAGAACCTGCCTCAGGCTCCCTTTAATCCGTACGCCGAG
GATCACAACGCCATGGCCGGTAGCTCATCTTTCTTCCCTCCGCAGGGCGCCTTCAACACTCCTCTCCAGCCGCTG
CAGCACCATCTGTACGCGCCATGGGGTCCGCGCCGAGAAGACCTGATGCCCTACCACCGGATGGCTCACGAATTC
TTCATGCCGGAAAAGCTGCGTCAAGAAATGCAGAAAAAGGCGGAGGCTACGCTTCAGGTCATCCCAAACTCCCAG
CTGCCGCAACTTGACAATTATCACTCACTCGTCGCCCTGGATACGACGCATAGGAAGAATCCCAGCATCTTCGGC
TACCCAAGCTGGGTTTACAAGGCAACGTCCATCAAGACCGGTCACGTCTATCTTCTGCGCCGCCTCGAAGGCTTC
CGCCTCACAAACGAACACGCTATCCGATCTGTCAAGGAATGGCGGAAGGTTGACAATGCAAACGTGGTCACGGTG
CACGACGCTTTTACCGCGAGGGCCTTTGGTGACAGTTCCCTCATCTTTGTTCAGGATTACTTTCCGCTATCAAAG
ACGCTGGCCGAGGTTCATTTCGCCGTCGGCTCGGGCCCGAGTAACCGATATCAGCCCAAGGGGCCGATCGCGGAG
CCGGCTCTGTGGTCTTACATTGCCCAGATCGCCAACGCCCTCAAGGCCATTCACGCGGCCAACCTGGCTGCTCGG
TGCGTCGACGCCTCCAAGATCATACTGACTGATAAGAATCGTGTGCGACTCAACGCCTGCGCCGTACTCGACGTG
GTTCAATATGAGATGAGACGGCCTCTGCGTGAGTTGCAGCAGGACGATCTTGTTCAGTTCGGACGCACTATGCTA
TGCCTGGCCACCAGCACGCCATCGGCCCTCATGACGAACCTCAACGCTTCCGTCGAGCAGATGAGCCGCACGTAC
TCGGCCGAGCTTCGCGATACTATCGTCTGGCTCCTGACTCCTCAGCAGCCTCCCGCAGTCAAGTCGATGGACGAG
TTCATCCGCGGTGTCGCCGGCCACATCGTCACGGCCTTTGAGGAGAGCCAGCATAGCAACGATCAACTAAACGCC
GAGCTCTTCCGCGAGTTGGAAAACGGTCGCATCGCGCGTTTGCTCATGAAGCTCGGGACGGTCAACGAGCGCTAC
GAGTTTGACGGCGACCGCGCCTGGTCGGAGAATGGCGAGCGTTACATGCTCAAGCTCTTCCGCGACTACGTCTTC
CACCAGGTCGACGGCAGCGGAAACCCGGTCGTCGATGTAGGCCACATGGTGCGCTGCCTCAACAGGCTCGACGCC
GGCACCGAAGAGCGCGTCTGTCTCACCAGCCGAGACGAGCAGACCAGCTTCCTCGTGAGCTATAAGGAACTCAAG
AAGCAGCTGGGCAATGCTTTTGGCGAGCTGCAAAAGGGCAGCGCTGGCGGCGCCGGCAAGCAGCAGGGCAGGGGT
TCTAGTCGGACCCCAGCAGCGGGGGGGGTCATCGCGCGGGAGGGGAGCCGCGGGAAGGGGAGCGGCCGGAGGGGA
GGGCCTCACCCCGGCCATTGCCCTGCTCCTATGCCGAGTCAGCTAGAGCGAGGCCAGTTCTTGGATTCGAACGAT
GGAGGGGAGAAAGGGGTGAAACCACTGGGTGCCGCCGGCGGTGGGCGGAGCCGCTCCGAGGGGCAGTCTGGCCCC
GAGGCCGGAGCGTTGAAGCAAGAGGAGACGGGAGACGGTCCTCTCAAGGGGGGCAAAAGCTCTCATGCGGGCATC
AAGTTTCGTCCTGATGCTGCCGAGTTTGTGCCCGGCATGAAGCTCCGGGTGACGGACGAGGGTGGTCAGGAGGAG
AGGGTGGAAGATGGACTGCTTCCTACGGTGCCTCCCAAGGGACCTGCCAAGAAGCCTCACACGGGGTCACTCCCG
GGGCATGCCAAGGAGCCTGATATCGAACCTCCCAAGGGGCTTGCCAAGAGGTCTCTTCCCAAGGGGCTTCCTATG
AAGCCGCCTTCGGGGCGTCCCACGAGACTTCCACCAGGGCGTGCCGACGAGCCTCACAGGCAGCCCCAATCGGGG
CCTCCTATTGGGCATTTTGGTCCTCTGAATCCTTTCATGGGGCCTTTCGACGGGCCTCTCATGGGACCTCCTATG
GGGCCTCCTATGGTGCCTCCTACGGGGCCTCCTATGGGACTACCCGTGATGCCTGATGGTCGTCTGGGAGGACAC
AGCACAGGGGGGGCAGGATCTGGTCCTCACGGGGCTGCCACTGGCGGACCTCATATTCCTCGTCACGATTACGAC
CCTCGCATGGGAGGCCAGCCCCCTCCTCAAGGAGCGTTGGAAAGACACTGGTAA
Transcript >Ophcf2|03030
ATGGCGACCTCGCGTTTCCCCTCGAGCGATCTTCGCCGTCAGCTCGGTTCTCCGAGGCCCAAGGCACGAGAAAAC
AAGGAAACGCTATGCAGAAATGTCCTCATCTACGGCCACTGCCGCTATGAAGAACAGGGCTGTTCTTTTTCTCAT
GACCCCAATAGAAATAATGCAAACAGCACCAGTAATAATGGAGGCCCGGACGGGTCCAAGAAGGCGCTCAACGTC
GAATCGCCCTCCTTCACCCCGGCCAGTATTCTTCCTCCCGCCCTCAAAAAGGCCACCATTCCAACCCAGGCCGCG
AGCGCTCCGGCCTTCACTCCACGAGCCATGAGCGGCACTCCCGTCACGGCTCCGGCAGAAGTCGATGCCGCCGTC
TTCAACCCAGCTGCTATACGCGAGTTCACTCCAGGTCTCGACGTCAGCTCTCAGCCGCCCAACGGCTCGAACCAA
GATCCCTTTGATGCCTTTGCCATGGCCGCCGTCGGCCAGAACCTGCCTCAGGCTCCCTTTAATCCGTACGCCGAG
GATCACAACGCCATGGCCGGTAGCTCATCTTTCTTCCCTCCGCAGGGCGCCTTCAACACTCCTCTCCAGCCGCTG
CAGCACCATCTGTACGCGCCATGGGGTCCGCGCCGAGAAGACCTGATGCCCTACCACCGGATGGCTCACGAATTC
TTCATGCCGGAAAAGCTGCGTCAAGAAATGCAGAAAAAGGCGGAGGCTACGCTTCAGGTCATCCCAAACTCCCAG
CTGCCGCAACTTGACAATTATCACTCACTCGTCGCCCTGGATACGACGCATAGGAAGAATCCCAGCATCTTCGGC
TACCCAAGCTGGGTTTACAAGGCAACGTCCATCAAGACCGGTCACGTCTATCTTCTGCGCCGCCTCGAAGGCTTC
CGCCTCACAAACGAACACGCTATCCGATCTGTCAAGGAATGGCGGAAGGTTGACAATGCAAACGTGGTCACGGTG
CACGACGCTTTTACCGCGAGGGCCTTTGGTGACAGTTCCCTCATCTTTGTTCAGGATTACTTTCCGCTATCAAAG
ACGCTGGCCGAGGTTCATTTCGCCGTCGGCTCGGGCCCGAGTAACCGATATCAGCCCAAGGGGCCGATCGCGGAG
CCGGCTCTGTGGTCTTACATTGCCCAGATCGCCAACGCCCTCAAGGCCATTCACGCGGCCAACCTGGCTGCTCGG
TGCGTCGACGCCTCCAAGATCATACTGACTGATAAGAATCGTGTGCGACTCAACGCCTGCGCCGTACTCGACGTG
GTTCAATATGAGATGAGACGGCCTCTGCGTGAGTTGCAGCAGGACGATCTTGTTCAGTTCGGACGCACTATGCTA
TGCCTGGCCACCAGCACGCCATCGGCCCTCATGACGAACCTCAACGCTTCCGTCGAGCAGATGAGCCGCACGTAC
TCGGCCGAGCTTCGCGATACTATCGTCTGGCTCCTGACTCCTCAGCAGCCTCCCGCAGTCAAGTCGATGGACGAG
TTCATCCGCGGTGTCGCCGGCCACATCGTCACGGCCTTTGAGGAGAGCCAGCATAGCAACGATCAACTAAACGCC
GAGCTCTTCCGCGAGTTGGAAAACGGTCGCATCGCGCGTTTGCTCATGAAGCTCGGGACGGTCAACGAGCGCTAC
GAGTTTGACGGCGACCGCGCCTGGTCGGAGAATGGCGAGCGTTACATGCTCAAGCTCTTCCGCGACTACGTCTTC
CACCAGGTCGACGGCAGCGGAAACCCGGTCGTCGATGTAGGCCACATGGTGCGCTGCCTCAACAGGCTCGACGCC
GGCACCGAAGAGCGCGTCTGTCTCACCAGCCGAGACGAGCAGACCAGCTTCCTCGTGAGCTATAAGGAACTCAAG
AAGCAGCTGGGCAATGCTTTTGGCGAGCTGCAAAAGGGCAGCGCTGGCGGCGCCGGCAAGCAGCAGGGCAGGGGT
TCTAGTCGGACCCCAGCAGCGGGGGGGGTCATCGCGCGGGAGGGGAGCCGCGGGAAGGGGAGCGGCCGGAGGGGA
GGGCCTCACCCCGGCCATTGCCCTGCTCCTATGCCGAGTCAGCTAGAGCGAGGCCAGTTCTTGGATTCGAACGAT
GGAGGGGAGAAAGGGGTGAAACCACTGGGTGCCGCCGGCGGTGGGCGGAGCCGCTCCGAGGGGCAGTCTGGCCCC
GAGGCCGGAGCGTTGAAGCAAGAGGAGACGGGAGACGGTCCTCTCAAGGGGGGCAAAAGCTCTCATGCGGGCATC
AAGTTTCGTCCTGATGCTGCCGAGTTTGTGCCCGGCATGAAGCTCCGGGTGACGGACGAGGGTGGTCAGGAGGAG
AGGGTGGAAGATGGACTGCTTCCTACGGTGCCTCCCAAGGGACCTGCCAAGAAGCCTCACACGGGGTCACTCCCG
GGGCATGCCAAGGAGCCTGATATCGAACCTCCCAAGGGGCTTGCCAAGAGGTCTCTTCCCAAGGGGCTTCCTATG
AAGCCGCCTTCGGGGCGTCCCACGAGACTTCCACCAGGGCGTGCCGACGAGCCTCACAGGCAGCCCCAATCGGGG
CCTCCTATTGGGCATTTTGGTCCTCTGAATCCTTTCATGGGGCCTTTCGACGGGCCTCTCATGGGACCTCCTATG
GGGCCTCCTATGGTGCCTCCTACGGGGCCTCCTATGGGACTACCCGTGATGCCTGATGGTCGTCTGGGAGGACAC
AGCACAGGGGGGGCAGGATCTGGTCCTCACGGGGCTGCCACTGGCGGACCTCATATTCCTCGTCACGATTACGAC
CCTCGCATGGGAGGCCAGCCCCCTCCTCAAGGAGCGTTGGAAAGACACTGGTAA
Gene >Ophcf2|03030
ATGGCGACCTCGCGTTTCCCCTCGAGCGATCTTCGCCGTCAGCTCGGTTCTCCGAGGCCCAAGGCACGAGGCACG
TTGCCCTTGTCTTCTCTCGCTCCCTTGGCTTCTTTCGCTGACGTTTGCGGCAGAAAACAAGGAAACGCTATGCAG
AAATGTCCTCATCTACGGCCACTGCCGCTATGAAGAACAGGGCTGTTCTTTTTCTCATGACCCCAATAGAAATAA
TGCAAACAGCACCAGTAATAATGGAGGCCCGGACGGGTGTGTCCCCCCCCCCCTTTTGCTCCGCCTTTTCTTTGC
CAGCTGGCAGACTAACGCCACTTCAGGTCCAAGAAGGCGCTCAACGTCGAATCGCCCTCCTTCACCCCGGCCAGT
ATTCTTCCTCCCGCCCTCAAAAAGGCCACCATTCCAACCCAGGCCGCGAGCGCTCCGGCCTTCACTCCACGAGCC
ATGAGCGGTATAGACACCCGACTTGCCACTGCTGGCTCCAGCTCTCTGACGCGCGCCTTCGTAGGCACTCCCGTC
ACGGCTCCGGCAGAAGTCGATGCCGCCGTCTTCAACCCAGCTGCTATACGCGAGTTCACTCCAGGTCTCGACGTC
AGCTCTCAGGTGAGAACTCCTCTCCATTTTCTTACTCCCCACGCTAACACAGAGCAAGCCGCCCAACGGCTCGAA
CCAAGATCCCTTTGATGCCTTTGCCATGGCCGCCGTCGGCCAGAACCTGCCTCAGGCTCCCTTTAATCCGTACGC
CGAGGATCACAACGCCATGGCCGGTAGCTCATCTTTCTTCCCTCCGCAGGGCGCCTTCAACACTCCTCTCCAGCC
GCTGCAGCACCATCTGTACGCGCCATGGGGTCCGCGCCGAGAAGACCTGATGCCCTACCACCGGATGGCTCACGA
ATTCTTCATGCCGGAAAAGCTGCGTCAAGAAATGCAGAAAAAGGCGGAGGCTACGCTTCAGGTCATCCCAAACTC
CCAGCTGCCGCAACTTGACAATTATCACTCACTCGTCGCCCTGGATACGACGCATAGGAAGAATCCCAGCATCTT
CGGCTACCCAAGCTGGGTTTACAAGGCAACGTCCATCAAGACCGGTCACGTCTATCTTCTGCGCCGCCTCGAAGG
CTTCCGCCTCACAAACGAACACGCTATCCGATCTGTCAAGGAATGGCGGAAGGTTGACAATGCAAACGTGGTCAC
GGTGCACGACGCTTTTACCGCGAGGGCCTTTGGTGACAGTTCCCTCATCTTTGTTCAGGATTACTTTCCGCTATC
AAAGACGCTGGCCGAGGTTCATTTCGCCGTCGGCTCGGGCCCGAGTAACCGATATCAGCCCAAGGGGCCGATCGC
GGAGCCGGCTCTGTGGTCTTACATTGCCCAGATCGCCAACGCCCTCAAGGCCATTCACGCGGCCAACCTGGCTGC
TCGGTGCGTCGACGCCTCCAAGATCATACTGACTGATAAGAATCGTGTGCGACTCAACGCCTGCGCCGTACTCGA
CGTGGTTCAATATGAGATGAGACGGCCTCTGCGTGAGTTGCAGCAGGACGATCTTGTTCAGTTCGGACGCACTAT
GCTATGCCTGGCCACCAGCACGCCATCGGCCCTCATGACGAACCTCAACGCTTCCGTCGAGCAGATGAGCCGCAC
GTACTCGGCCGAGCTTCGCGATACTATCGTCTGGCTCCTGACTCCTCAGCAGCCTCCCGCAGTCAAGTCGATGGA
CGAGTTCATCCGCGGTGTCGCCGGCCACATCGTCACGGCCTTTGAGGAGAGCCAGCATAGCAACGATCAACTAAA
CGCCGAGCTCTTCCGCGAGTTGGAAAACGGTCGCATCGCGCGTTTGCTCATGAAGCTCGGGACGGTCAACGAGCG
CTACGAGTTTGACGGCGACCGCGCCTGGTCGGAGAATGGCGAGCGTTACATGCTCAAGCTCTTCCGCGACTACGT
CTTCCACCAGGTCGACGGCAGCGGAAACCCGGTCGTCGATGTAGGCCACATGGTGCGCTGCCTCAACAGGCTCGA
CGCCGGCACCGAAGAGCGCGTCTGTCTCACCAGCCGAGACGAGCAGACCAGCTTCCTCGTGAGCTATAAGGAACT
CAAGAAGCAGCTGGGCAATGCTTTTGGCGAGCTGCAAAAGGGCAGCGCTGGCGGCGCCGGCAAGCAGCAGGGCAG
GGGTTCTAGTCGGACCCCAGCAGCGGGGGGGGTCATCGCGCGGGAGGGGAGCCGCGGGAAGGGGTCGGGCTGCTG
CGGCAGCTCCCTCCCGCGGCACTACGCGCCACCGGTCGCCCGTCAAAAGGAGCGGCCGGAGGGGAGGGCCTCACC
CCGGCCATTGCCCTGCTCCTATGCCGAGTCAGCTAGAGCGAGGCCAGTTCTTGGATTCGAACGATGGAGGGGAGA
AAGGGGTGAAACCACTGGGTGCCGCCGGCGGTGGGCGGAGCCGCTCCGAGGGGCAGTCTGGCCCCGAGGCCGGAG
CGTTGAAGCAAGAGGAGACGGGAGACGGTCCTCTCAAGGGGGGCAAAAGCTCTCATGCGGGCATCAAGTTTCGTC
CTGATGCTGCCGAGTTTGTGCCCGGCATGAAGCTCCGGGTGACGGACGAGGGTGGTCAGGAGGAGAGGGTGGAAG
ATGGACTGCTTCCTACGGTGCCTCCCAAGGGACCTGCCAAGAAGCCTCACACGGGGTCACTCCCGGGGCATGCCA
AGGAGCCTGATATCGAACCTCCCAAGGGGCTTGCCAAGAGGTCTCTTCCCAAGGGGCTTCCTATGAAGCCGCCTT
CGGGGCGTCCCACGAGACTTCCACCAGGGCGTGCCGACGAGCCTCACAGGCAGCCCCAATCGGGGCCTCCTATTG
GGCATTTTGGTCCTCTGAATCCTTTCATGGGGCCTTTCGACGGGCCTCTCATGGGACCTCCTATGGGGCCTCCTA
TGGTGCCTCCTACGGGGCCTCCTATGGGACTACCCGTGATGCCTGATGGTCGTCTGGGAGGACACAGCACAGGGG
GGGCAGGATCTGGTCCTCACGGGGCTGCCACTGGCGGACCTCATATTCCTCGTCACGATTACGACCCTCGCATGG
GAGGCCAGCCCCCTCCTCAAGGAGCGTTGGAAAGACACTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail