Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03026
Gene name
Locationscaffold_03:455651..457616
Strand-
Gene length (bp)1965
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04185 Phosphoesterase Phosphoesterase family 2.2E-76 25 397

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1183 0.1381 0.8454 0.1499 0.0813 0.03 0.1823 0.4713 0.1333 0.0076

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999369

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.02 0.00 0.10
Alive In ants, during behavior modification 36.92 19.05 54.78
Dead In ants, recently dead 7.01 2.60 11.43

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.342133 no
Alive Dead 0.000238 yes
Dead Fungus 0.342133 no

Orthologs

Orthofinder run ID4
Orthogroup585
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2380
Ophiocordyceps australis map64 (Brazil) OphauB2|3830
Ophiocordyceps camponoti-floridani Ophcf2|03026 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3412
Ophiocordyceps kimflemingae Ophio5|4794
Ophiocordyceps subramaniannii Hirsu2|6220
Ophiocordyceps subramaniannii Hirsu2|7145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03026
MALLGIYVLLTHGIYAAHAASIADIDHVVLFMQENRAFDHYLGTMAGVRGFNDANLQLNNGVPVWRQLTSPKLTN
DSGFVSPWYLNYLGGNWSDATQCMLAGSNGWFENHAAWNKGANNRWAVDNTPWSLGFYKRCDVPVQWALADGWVV
ADMYQESVVASTSPNRVTWISGSINVPGSPQRSDQGGNPYIDNNETPGCEKGAINCYPLKWKTAAELYQRAGVSW
QVYQDADNFDDNPFAWFKQFQDARRGSSLHGRGVKGLSLDTFYQQAANGSLPEISYIVGPTELSEHTPYSPHDGA
WLQRNIASAIIKSPKYANTVLIISYDETGGWFDHVDPFRAPEGTPGEWLDDPYNKVGRTFSGPGFRVPMYIISPW
TRRGGVYTEHADHNSQLLFIERWQASKGRNVTTLEMGPWRREKMGDLVAAFDFSTPDYGLPALPDASEPHKDARG
VYDGSAHCMALFDATRPPVPYKGEGVIHDMASQVERGFKPIRGRLTQGRFLVLETGSHALTAPPGTKRATLTAST
EQHDCPRQRWIAHAKKRGGDEFTLSSAVDGRFLCREAELCREEARALIVVVDFLPGEGYALGVGGVYLGVVEGAL
GFVRREQRWSMFSVSY*
Coding >Ophcf2|03026
ATGGCTCTCCTCGGAATCTACGTCCTCCTTACCCATGGAATCTACGCTGCCCATGCCGCCAGCATAGCAGACATC
GACCACGTCGTCCTCTTCATGCAAGAGAACCGCGCCTTCGACCACTATCTAGGCACCATGGCCGGCGTCCGCGGC
TTCAACGACGCCAACCTCCAGCTCAACAACGGCGTCCCCGTGTGGAGGCAGCTTACCAGTCCGAAACTGACAAAC
GACTCCGGCTTCGTCTCTCCTTGGTATCTCAACTATCTCGGGGGTAACTGGTCGGATGCGACGCAGTGTATGCTG
GCGGGTTCCAACGGATGGTTCGAGAATCACGCCGCGTGGAATAAGGGGGCTAATAACCGGTGGGCGGTGGACAAT
ACGCCTTGGAGCCTTGGCTTCTATAAGCGGTGTGACGTTCCGGTGCAGTGGGCGCTTGCTGACGGCTGGGTTGTC
GCCGACATGTATCAAGAATCCGTCGTGGCATCCACGTCCCCCAACAGAGTGACCTGGATCAGCGGCTCCATCAAC
GTACCCGGAAGTCCACAGAGGTCGGATCAAGGAGGGAACCCCTACATCGACAACAACGAGACGCCCGGCTGTGAA
AAGGGCGCCATCAACTGCTACCCTCTCAAGTGGAAGACGGCGGCCGAGCTTTACCAGCGAGCCGGTGTGTCGTGG
CAGGTGTATCAGGACGCTGACAACTTTGACGATAACCCGTTTGCCTGGTTCAAGCAGTTTCAAGATGCGAGAAGG
GGATCGAGTTTGCATGGTAGAGGAGTAAAGGGTCTTTCGCTCGATACCTTTTACCAGCAGGCTGCCAACGGCTCC
CTCCCCGAGATATCCTACATCGTCGGTCCGACAGAACTATCAGAGCACACGCCCTACTCCCCCCACGACGGCGCC
TGGCTCCAACGGAACATAGCCTCAGCCATCATCAAGTCACCCAAATACGCAAACACGGTACTCATAATCTCCTAC
GACGAAACGGGCGGCTGGTTCGACCACGTGGATCCTTTCCGAGCCCCCGAAGGCACACCGGGCGAGTGGCTCGAC
GATCCTTACAACAAAGTAGGCCGCACCTTTTCCGGCCCTGGCTTCCGCGTGCCAATGTACATCATCTCACCCTGG
ACGCGAAGAGGCGGCGTCTACACCGAGCACGCCGATCACAACTCGCAGCTGCTCTTCATCGAGCGCTGGCAGGCT
TCCAAGGGACGGAACGTGACGACGCTGGAGATGGGGCCCTGGAGAAGGGAGAAGATGGGCGATCTCGTTGCTGCC
TTTGACTTTTCCACGCCGGACTATGGCTTGCCTGCGTTGCCGGATGCGTCGGAACCGCACAAGGACGCCAGGGGG
GTTTACGATGGTTCGGCACATTGCATGGCGCTCTTTGACGCCACGAGGCCTCCCGTTCCGTACAAGGGCGAGGGG
GTCATCCACGACATGGCCTCTCAGGTGGAAAGGGGCTTCAAGCCCATACGCGGCCGCCTCACCCAAGGCCGCTTC
CTCGTCCTAGAGACGGGATCCCACGCACTAACAGCCCCCCCGGGAACCAAAAGGGCGACCCTCACAGCCAGCACA
GAACAGCACGACTGCCCTCGGCAGCGATGGATCGCCCACGCCAAGAAGAGGGGCGGCGACGAGTTCACGCTGAGC
AGTGCCGTCGACGGCCGCTTTCTCTGCCGAGAGGCAGAGTTGTGTCGCGAGGAGGCGAGGGCTTTGATCGTCGTC
GTCGACTTCTTGCCCGGGGAGGGGTACGCGTTGGGGGTTGGCGGCGTGTATTTGGGGGTTGTTGAGGGGGCGTTG
GGCTTTGTGAGGAGGGAACAGAGGTGGAGCATGTTTTCTGTGAGTTATTGA
Transcript >Ophcf2|03026
ATGGCTCTCCTCGGAATCTACGTCCTCCTTACCCATGGAATCTACGCTGCCCATGCCGCCAGCATAGCAGACATC
GACCACGTCGTCCTCTTCATGCAAGAGAACCGCGCCTTCGACCACTATCTAGGCACCATGGCCGGCGTCCGCGGC
TTCAACGACGCCAACCTCCAGCTCAACAACGGCGTCCCCGTGTGGAGGCAGCTTACCAGTCCGAAACTGACAAAC
GACTCCGGCTTCGTCTCTCCTTGGTATCTCAACTATCTCGGGGGTAACTGGTCGGATGCGACGCAGTGTATGCTG
GCGGGTTCCAACGGATGGTTCGAGAATCACGCCGCGTGGAATAAGGGGGCTAATAACCGGTGGGCGGTGGACAAT
ACGCCTTGGAGCCTTGGCTTCTATAAGCGGTGTGACGTTCCGGTGCAGTGGGCGCTTGCTGACGGCTGGGTTGTC
GCCGACATGTATCAAGAATCCGTCGTGGCATCCACGTCCCCCAACAGAGTGACCTGGATCAGCGGCTCCATCAAC
GTACCCGGAAGTCCACAGAGGTCGGATCAAGGAGGGAACCCCTACATCGACAACAACGAGACGCCCGGCTGTGAA
AAGGGCGCCATCAACTGCTACCCTCTCAAGTGGAAGACGGCGGCCGAGCTTTACCAGCGAGCCGGTGTGTCGTGG
CAGGTGTATCAGGACGCTGACAACTTTGACGATAACCCGTTTGCCTGGTTCAAGCAGTTTCAAGATGCGAGAAGG
GGATCGAGTTTGCATGGTAGAGGAGTAAAGGGTCTTTCGCTCGATACCTTTTACCAGCAGGCTGCCAACGGCTCC
CTCCCCGAGATATCCTACATCGTCGGTCCGACAGAACTATCAGAGCACACGCCCTACTCCCCCCACGACGGCGCC
TGGCTCCAACGGAACATAGCCTCAGCCATCATCAAGTCACCCAAATACGCAAACACGGTACTCATAATCTCCTAC
GACGAAACGGGCGGCTGGTTCGACCACGTGGATCCTTTCCGAGCCCCCGAAGGCACACCGGGCGAGTGGCTCGAC
GATCCTTACAACAAAGTAGGCCGCACCTTTTCCGGCCCTGGCTTCCGCGTGCCAATGTACATCATCTCACCCTGG
ACGCGAAGAGGCGGCGTCTACACCGAGCACGCCGATCACAACTCGCAGCTGCTCTTCATCGAGCGCTGGCAGGCT
TCCAAGGGACGGAACGTGACGACGCTGGAGATGGGGCCCTGGAGAAGGGAGAAGATGGGCGATCTCGTTGCTGCC
TTTGACTTTTCCACGCCGGACTATGGCTTGCCTGCGTTGCCGGATGCGTCGGAACCGCACAAGGACGCCAGGGGG
GTTTACGATGGTTCGGCACATTGCATGGCGCTCTTTGACGCCACGAGGCCTCCCGTTCCGTACAAGGGCGAGGGG
GTCATCCACGACATGGCCTCTCAGGTGGAAAGGGGCTTCAAGCCCATACGCGGCCGCCTCACCCAAGGCCGCTTC
CTCGTCCTAGAGACGGGATCCCACGCACTAACAGCCCCCCCGGGAACCAAAAGGGCGACCCTCACAGCCAGCACA
GAACAGCACGACTGCCCTCGGCAGCGATGGATCGCCCACGCCAAGAAGAGGGGCGGCGACGAGTTCACGCTGAGC
AGTGCCGTCGACGGCCGCTTTCTCTGCCGAGAGGCAGAGTTGTGTCGCGAGGAGGCGAGGGCTTTGATCGTCGTC
GTCGACTTCTTGCCCGGGGAGGGGTACGCGTTGGGGGTTGGCGGCGTGTATTTGGGGGTTGTTGAGGGGGCGTTG
GGCTTTGTGAGGAGGGAACAGAGGTGGAGCATGTTTTCTGTGAGTTATTGA
Gene >Ophcf2|03026
ATGGCTCTCCTCGGAATCTACGTCCTCCTTACCCATGGAATCTACGCTGCCCATGCCGCCAGCATAGCAGACATC
GACCACGTCGTCCTCTTCATGCAAGGTCCCATGACCGAAACCCCAACCCGATCCCCTCCCCCCCCCATCACGACC
AGCTAACAACAGCAGAGAACCGCGCCTTCGACCACTATCTAGGCACCATGGCCGGCGTCCGCGGCTTCAACGACG
CCAACCTCCAGCTCAACAACGGCGTCCCCGTGTGGAGGCAGCTTACCAGTCCGAAACTGACAAACGACTCCGGCT
TCGTCTCTCCTTGGTATCTCAACTATCTCGGGGGTAACTGGTCGGATGCGACGCAGTGTATGCTGGCGGGTTCCA
ACGGATGGTTCGAGAATCACGCCGCGTGGAATAAGGGGGCTAATAACCGGTGGGCGGTGGACAATACGCCTTGGA
GCCTTGGCTTCTATAAGCGGTGTGACGTTCCGGTGCAGTGGGCGCTTGCTGACGGCTGGGTTGTCGCCGACATGT
ATCAAGTACGCACCGTGGTGCCCTCTATTCCAAGCCCAGAAACTCACGTCTCAGGAATCCGTCGTGGCATCCACG
TCCCCCAACAGAGTGACCTGGATCAGCGGCTCCATCAACGTACCCGGAAGTCCACAGAGGTCGGATCAAGGAGGG
AACCCCTACATCGACAACAACGAGACGCCCGGCTGTGAAAAGGGCGCCATCAACTGCTACCCTCTCAAGTGGAAG
ACGGCGGCCGAGCTTTACCAGCGAGCCGGTGTGTCGTGGCAGGTGTATCAGGACGCTGACAACTTTGACGATAAC
CCGTTTGCCTGGTTCAAGCAGTTTCAAGATGCGAGAAGGGGATCGAGTTTGCATGGTAGAGGAGTAAAGGGTCTT
TCGCTCGATACCTTTTACCAGCAGGCTGCCAACGGCTCCCTCCCCGAGATATCCTACATCGTCGGTCCGACAGAA
CTATCAGAGCACACGCCCTACTCCCCCCACGACGGCGCCTGGCTCCAACGGAACATAGCCTCAGCCATCATCAAG
TCACCCAAATACGCAAACACGGTACTCATAATCTCCTACGACGAAACGGGCGGCTGGTTCGACCACGTGGATCCT
TTCCGAGCCCCCGAAGGCACACCGGGCGAGTGGCTCGACGATCCTTACAACAAAGTAGGCCGCACCTTTTCCGGC
CCTGGCTTCCGCGTGCCAATGTACATCATCTCACCCTGGACGCGAAGAGGCGGCGTCTACACCGAGCACGCCGAT
CACAACTCGCAGCTGCTCTTCATCGAGCGCTGGCAGGCTTCCAAGGGACGGAACGTGACGACGCTGGAGATGGGG
CCCTGGAGAAGGGAGAAGATGGGCGATCTCGTTGCTGCCTTTGACTTTTCCACGCCGGACTATGGCTTGCCTGCG
TTGCCGGATGCGTCGGAACCGCACAAGGACGCCAGGGGGGTTTACGATGGTTCGGCACATTGCATGGCGCTCTTT
GACGCCACGAGGCCTCCCGTTCCGTACAAGGGCGAGGGGGTCATCCACGACATGGCCTCTCAGGTGGAAAGGGGC
TTCAAGCCCATACGCGGCCGCCTCACCCAAGGCCGCTTCCTCGTCCTAGAGACGGGATCCCACGCACTAACAGCC
CCCCCGGGAACCAAAAGGGCGACCCTCACAGCCAGCACAGAACAGCACGACTGCCCTCGGCAGCGATGGATCGCC
CACGCCAAGAAGAGGGGCGGCGACGAGTTCACGCTGAGCAGTGCCGTCGACGGCCGCTTTCTCTGCCGAGAGGCA
GAGTTGTGTCGCGAGGAGGCGAGGGCTTTGATCGTCGTCGTCGACTTCTTGCCCGGGGAGGGGTACGCGTTGGGG
GTTGGCGGCGTGTATTTGGGGGTTGTTGAGGGGGCGTTGGGCTTTGTGAGGAGGGAACAGAGGTGGAGCATGTTT
TCTGTGAGTTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail