Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03024
Gene name
Locationscaffold_03:447230..448896
Strand+
Gene length (bp)1666
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 9.2E-15 28 181
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 2.1E-14 314 456

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 59 81 22
3 91 113 22
4 125 147 22
5 157 179 22
6 311 333 22
7 348 370 22
8 377 399 22
9 409 431 22
10 444 466 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03024
MVISSPLNALLVFVPVGLVSEMAGLGPVVIFATNAAAIVPLSALLTDATERVAAHAGDTVGALLNISLGNLVELI
LFIAALCHDHVRIVQASILGSLLVNLLLILGSALIVGNDEPAYNAADAQLLACLLSVSVFTFLIPTAFNFAFSSA
SHSSGLISLSFSRISSLLILAIYVLYLVHEIRSRCRPVVLVDLESSLSAAERRQLPPPLLPLNSPPQPLSPRTIR
FVQDGLLPGRGRRLVDSTAGFRPRADSWQPPISRKVSPSRRDSSVGDIRSNLSRSSLTLRILRDVHLDRHQPVSQ
DDGQGSRKEVVVAIAMLVLTSGLMSLNAELLVGTINQVTRRTNLSEPVIGLILLPIVGNVAEYVTVVAVAAREKL
HLAVAVAVGSSIQIALCVTPLTLLAGWLLHRDLALTFNTFEMATLVGAVLLVNLLILSETGSTLRTGGLKGVLMC
ACYIIIGLGAYFAPAIEA*
Coding >Ophcf2|03024
ATGGTGATCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGTCAGCGAGATGGCTGGGCTT
GGACCCGTCGTCATCTTCGCGACGAATGCTGCGGCTATTGTGCCCTTGTCTGCGCTTTTGACGGATGCGACTGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGGTGCGCTGCTCAACATCAGTCTTGGGAACTTGGTTGAGCTCATC
TTGTTCATCGCCGCCCTCTGTCACGATCACGTTCGTATCGTCCAGGCCTCTATCCTCGGCTCCCTTCTCGTCAAC
CTGCTCCTTATCCTCGGCTCGGCTCTCATCGTCGGCAATGACGAACCGGCTTACAACGCGGCCGATGCCCAGCTT
CTCGCCTGTCTGCTCTCCGTCTCCGTCTTTACCTTTTTGATTCCTACGGCCTTCAACTTCGCCTTCAGCTCTGCG
TCGCACTCCTCGGGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTACGTCCTC
TACCTAGTTCACGAGATACGATCCCGCTGCCGGCCCGTTGTCCTCGTCGACTTGGAGAGCAGTCTTTCCGCAGCG
GAGAGGCGTCAACTTCCACCCCCTCTGCTCCCCCTCAACAGCCCGCCGCAGCCTCTGTCGCCCCGGACGATTCGT
TTCGTCCAAGATGGCCTGCTTCCCGGTAGGGGTCGTCGTCTTGTCGATTCTACTGCTGGCTTTAGACCGCGTGCC
GACTCGTGGCAGCCTCCTATATCGCGCAAGGTGTCGCCTTCGAGGAGGGACTCTTCTGTCGGGGATATAAGGAGC
AACTTGTCGCGGTCAAGTCTCACGCTGCGTATCCTGCGAGACGTTCATCTTGATCGACATCAGCCCGTCAGCCAA
GATGATGGCCAAGGCAGTAGAAAGGAAGTCGTCGTCGCCATCGCCATGCTCGTCCTCACATCAGGACTCATGTCC
CTCAACGCCGAGCTCCTCGTCGGCACCATCAACCAAGTGACGCGTCGGACGAACCTATCAGAGCCCGTCATCGGC
CTCATCCTGCTGCCCATAGTCGGTAACGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAGAAGCTG
CATCTCGCCGTGGCTGTTGCTGTCGGGTCTTCGATACAGATCGCCTTGTGCGTCACTCCACTGACCCTTCTCGCT
GGCTGGCTTTTGCATCGCGACTTGGCTTTGACCTTTAACACGTTTGAGATGGCTACTCTTGTCGGTGCCGTCTTG
CTTGTCAATCTGCTTATTCTGAGCGAGACGGGAAGTACTCTGCGGACTGGTGGGCTCAAGGGCGTCTTGATGTGC
GCCTGTTACATCATCATCGGTCTAGGAGCGTACTTTGCTCCGGCCATCGAGGCGTAG
Transcript >Ophcf2|03024
ATGGTGATCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGTCAGCGAGATGGCTGGGCTT
GGACCCGTCGTCATCTTCGCGACGAATGCTGCGGCTATTGTGCCCTTGTCTGCGCTTTTGACGGATGCGACTGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGGTGCGCTGCTCAACATCAGTCTTGGGAACTTGGTTGAGCTCATC
TTGTTCATCGCCGCCCTCTGTCACGATCACGTTCGTATCGTCCAGGCCTCTATCCTCGGCTCCCTTCTCGTCAAC
CTGCTCCTTATCCTCGGCTCGGCTCTCATCGTCGGCAATGACGAACCGGCTTACAACGCGGCCGATGCCCAGCTT
CTCGCCTGTCTGCTCTCCGTCTCCGTCTTTACCTTTTTGATTCCTACGGCCTTCAACTTCGCCTTCAGCTCTGCG
TCGCACTCCTCGGGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTACGTCCTC
TACCTAGTTCACGAGATACGATCCCGCTGCCGGCCCGTTGTCCTCGTCGACTTGGAGAGCAGTCTTTCCGCAGCG
GAGAGGCGTCAACTTCCACCCCCTCTGCTCCCCCTCAACAGCCCGCCGCAGCCTCTGTCGCCCCGGACGATTCGT
TTCGTCCAAGATGGCCTGCTTCCCGGTAGGGGTCGTCGTCTTGTCGATTCTACTGCTGGCTTTAGACCGCGTGCC
GACTCGTGGCAGCCTCCTATATCGCGCAAGGTGTCGCCTTCGAGGAGGGACTCTTCTGTCGGGGATATAAGGAGC
AACTTGTCGCGGTCAAGTCTCACGCTGCGTATCCTGCGAGACGTTCATCTTGATCGACATCAGCCCGTCAGCCAA
GATGATGGCCAAGGCAGTAGAAAGGAAGTCGTCGTCGCCATCGCCATGCTCGTCCTCACATCAGGACTCATGTCC
CTCAACGCCGAGCTCCTCGTCGGCACCATCAACCAAGTGACGCGTCGGACGAACCTATCAGAGCCCGTCATCGGC
CTCATCCTGCTGCCCATAGTCGGTAACGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAGAAGCTG
CATCTCGCCGTGGCTGTTGCTGTCGGGTCTTCGATACAGATCGCCTTGTGCGTCACTCCACTGACCCTTCTCGCT
GGCTGGCTTTTGCATCGCGACTTGGCTTTGACCTTTAACACGTTTGAGATGGCTACTCTTGTCGGTGCCGTCTTG
CTTGTCAATCTGCTTATTCTGAGCGAGACGGGAAGTACTCTGCGGACTGGTGGGCTCAAGGGCGTCTTGATGTGC
GCCTGTTACATCATCATCGGTCTAGGAGCGTACTTTGCTCCGGCCATCGAGGCGTAG
Gene >Ophcf2|03024
ATGGTGATCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGTCAGCGAGATGGCTGGGCTT
GGACCCGTCGTCATCTTCGCGACGAATGCTGCGGCTATTGTGCCCTTGTCTGCGCTTTTGACGGATGCGACTGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGGTGCGCTGCTCAACATCAGTCTTGGGAACTTGGTTGAGCTCATC
TTGTTGTATGGCTTTCTCCTGCTTCGTGTTTCGTGTTGTACATAGACTGACCTTTTTCTCTGTGATGCAGCATGT
AAGTACATACGACTCTCGGCAAGTCGAAGCCCGTGTTTGCTCAATCTCTCAGCGCCGCCCTCTGTCACGATCACG
TTCGTATCGTCCAGGCCTCTATCCTCGGCTCCCTTCTCGTCAACCTGCTCCTTATCCTCGGCTCGGCTCTCATCG
TCGGCAATGACGAACCGGCTTACAACGCGGCCGATGCCCAGCTTCTCGCCTGTCTGCTCTCCGTCTCCGTCTTTA
CCTTTTTGATTCCTGTGAGAACTCTCTCTTTCTCTCTCTCTCTCTCTCTCTCTCTCTTCTCCGTGACATGGAAAA
CTAACTCCCTCCCTAACTGTAAAAGACGGCCTTCAACTTCGCCTTCAGCTCTGCGTCGCACTCCTCGGGCCTCAT
CAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTACGTCCTCTACCTAGTTCACGAGATACG
ATCCCGCTGCCGGCCCGTTGTCCTCGTCGACTTGGAGAGCAGTCTTTCCGCAGCGGAGAGGCGTCAACTTCCACC
CCCTCTGCTCCCCCTCAACAGCCCGCCGCAGCCTCTGTCGCCCCGGACGATTCGTTTCGTCCAAGATGGCCTGCT
TCCCGGTAGGGGTCGTCGTCTTGTCGATTCTACTGCTGGCTTTAGACCGCGTGCCGACTCGTGGCAGCCTCCTAT
ATCGCGCAAGGTGTCGCCTTCGAGGAGGGACTCTTCTGTCGGGGATATAAGGAGCAACTTGTCGCGGTCAAGTCT
CACGCTGCGTATCCTGCGAGACGTTCATCTTGATCGACATCAGCCCGTCAGCCAAGATGATGGCCAAGGCAGTAG
AAAGGAAGTCGTCGTCGCCATCGCCATGCTCGTCCTCACATCAGGACTCATGTCCCTCAACGCCGAGCTCCTCGT
CGGCACCATCAACCAAGTGACGCGTCGGACGAACCTATCAGAGCCCGTCATCGGCCTCATCCTGCTGCCCATAGT
CGGTAACGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAGAAGCTGCATCTCGCCGTGGCTGTTGC
TGTCGGGTCTTCGATACAGATCGCCTTGTGCGTCACTCCACTGACCCTTCTCGCTGGCTGGCTTTTGCATCGCGA
CTTGGCTTTGACCTTTAACACGTTTGAGATGGCTACTCTTGTCGGTGCCGTCTTGCTTGTCAATCTGCTTATTCT
GAGCGAGACGGGAAGTACTCTGCGGACTGGTGGGCTCAAGGGCGTCTTGATGTGCGCCTGTTACATCATCATCGG
GTGAGTTGCTGTCTCTTTGGAGGCTTGAACCTGTGTCTGACTTGTTCTCTGCAGTCTAGGAGCGTACTTTGCTCC
GGCCATCGAGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail