Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03020
Gene name
Locationscaffold_03:438202..441182
Strand+
Gene length (bp)2980
Transcript length (bp)2775
Coding sequence length (bp)2775
Protein length (aa) 925

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 1.3E-81 55 303
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 1.3E-65 553 751
PF02815 MIR MIR domain 1.1E-45 351 529

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006493 protein O-linked glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0044238 primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0006486 protein glycosylation No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0016758 hexosyltransferase activity No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043413 macromolecule glycosylation No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0008150 biological_process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 93 115 22
3 135 157 22
4 159 181 22
5 186 208 22
6 221 238 17
7 242 264 22
8 277 299 22
9 607 629 22
10 650 667 17
11 672 694 22
12 707 729 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03020
MAKTTASGGKSPPLPGRSSPPPRVKAKKNVSYQSDGVEDHDVFLLPVSDYVVTLCITVLATIVRIFRIYQPSSVV
FDEVHFGGFASKYIKGKFFMDVHPPLAKMLIALTGWLAGFDGNFDFKDIGKDYLEPGVPYVAMRMFPAVCGIALA
PFMFLTLKAIGSRTMTAAMGACLIIFENGLLTQARLILLDSPLVAATAFTVLAFTCFTNQHEQGPAKAFKPAWWF
WLAMTGLGLGTTVSIKWVGLFTIAWVGILTLVQLWVLLGDNRNVTLRLWVKHFMARIFCLVIIPVTFYLAMFAIH
FVCLVNPGDGDGFMSSEFQATLNSKGMKDVAADVVLGSRITMRHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKD
ENNVWLIENQTQPLGSDGQPINGTLAWDQLPDGPNYVTNGMVIRLYHQPTHRRLHSHDVRPPITEAEWQNEVSAY
GFDGFEGDANDLFRVEIVKKKSSGAVAKERLRTIETKFRLIHIMSGCVLFSHKVKLPDWASEQQEVTCARSGSLP
NSLWYVEYNEHPQLGEGVEKVNYRNPGFLGKFWELQQVMWRTNAGLVESHAWDSRPGSWPILRRGINFWGKHHTQ
IYLIGNPIVWWSSTLAVVVWVMFKAVAVLRWQRSCNDYSSATFKRFDYEIGTYVLGWMLHYFPFYLMQRQLFLHH
YFPALYFAVVALCQMFDYLTVRIPGVGARDGAVVNKAATVCFLALSAAAFSLYAPLAYGNHWTRGECSRVKVLST
WDWDCNNFYDSYEAYSSEGSFASPPAASTTAAKKSAEKVAAEISSPSPPPGPRAVSLEESVEYRDQDGNLLNAEQ
VEKLKGKVDFQTLYETRTRVLDEQGNELPMPEGGWPADIDAGVAPPHPDVEGVDKETVKAGGAEPPRHAAASRDG
EREAERARAKPGSEGKDATVRDEL*
Coding >Ophcf2|03020
ATGGCCAAGACCACCGCCAGCGGCGGCAAAAGCCCTCCGTTACCGGGCCGCTCCTCTCCGCCACCGAGGGTCAAG
GCCAAGAAGAACGTATCGTACCAGTCGGACGGAGTCGAGGATCACGATGTCTTCCTGTTGCCCGTGTCCGACTAC
GTCGTCACCCTCTGCATCACCGTCCTGGCCACCATCGTCCGTATATTTAGGATCTACCAGCCTTCGAGCGTTGTC
TTCGATGAGGTCCATTTCGGAGGCTTCGCGTCCAAGTACATCAAGGGCAAGTTCTTCATGGACGTCCACCCGCCC
CTCGCCAAGATGCTCATCGCCCTCACCGGCTGGCTCGCTGGCTTTGACGGCAACTTCGACTTCAAGGACATTGGA
AAGGACTACCTCGAGCCCGGCGTGCCCTACGTAGCCATGCGCATGTTCCCGGCTGTGTGTGGCATCGCCTTGGCC
CCCTTCATGTTCCTCACCCTCAAGGCCATCGGATCCCGTACAATGACGGCCGCCATGGGCGCTTGTCTCATCATA
TTCGAAAACGGTCTTTTGACCCAGGCCCGCCTGATCCTCCTCGACTCGCCTCTTGTCGCCGCCACGGCCTTTACT
GTTCTCGCCTTCACCTGCTTCACCAACCAGCACGAGCAGGGCCCTGCCAAGGCCTTCAAGCCCGCCTGGTGGTTC
TGGCTGGCAATGACTGGTCTCGGTCTCGGCACCACCGTCAGCATCAAATGGGTCGGCCTCTTCACCATCGCCTGG
GTTGGCATCCTGACCCTGGTCCAACTATGGGTGCTTCTCGGCGACAATCGAAACGTCACCCTGCGACTCTGGGTG
AAGCATTTCATGGCTAGAATCTTCTGCCTCGTCATCATTCCCGTCACCTTCTACCTCGCCATGTTCGCCATACAC
TTCGTCTGCCTCGTCAACCCCGGCGACGGCGACGGCTTCATGAGCTCCGAGTTTCAAGCGACGCTCAACAGCAAG
GGCATGAAGGACGTGGCCGCCGACGTGGTGCTGGGCAGCCGCATCACCATGCGTCACGTCAACACTCAGGGCGGC
TACCTTCATTCGCATCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACGCTGTATCCGCACAAAGAC
GAGAACAACGTCTGGCTCATCGAGAACCAGACGCAGCCGCTGGGTTCCGATGGCCAACCCATCAACGGCACGCTG
GCTTGGGATCAGCTACCCGACGGGCCGAACTACGTGACCAATGGCATGGTCATCCGGCTCTATCACCAGCCGACA
CACAGGCGACTGCATTCGCACGACGTGCGGCCGCCCATCACCGAGGCCGAGTGGCAGAACGAGGTGTCGGCCTAT
GGCTTCGACGGTTTCGAGGGCGATGCCAACGATCTGTTCCGCGTCGAGATTGTCAAGAAGAAGTCGTCGGGCGCC
GTGGCCAAGGAGCGGCTCCGCACCATCGAGACCAAGTTCAGGCTCATCCACATCATGTCCGGTTGCGTCCTCTTC
TCCCACAAGGTGAAGCTCCCCGACTGGGCCTCGGAGCAGCAGGAGGTGACGTGCGCTCGAAGCGGGTCGCTGCCC
AACAGCCTGTGGTACGTGGAATACAACGAGCACCCTCAGCTGGGCGAGGGAGTCGAAAAGGTCAACTATCGCAAC
CCGGGCTTCCTCGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCCGGCCTCGTCGAGTCTCAC
GCCTGGGATTCGCGGCCCGGCTCGTGGCCGATCCTGCGACGCGGCATCAACTTCTGGGGCAAGCACCATACGCAG
ATCTATCTGATCGGCAACCCCATCGTCTGGTGGTCGTCGACGCTGGCTGTCGTTGTCTGGGTCATGTTCAAGGCC
GTCGCCGTCCTCCGGTGGCAGCGCAGTTGCAACGACTACTCGAGCGCCACCTTTAAGCGCTTCGACTATGAGATA
GGCACCTACGTGCTCGGCTGGATGCTGCACTATTTCCCCTTTTACCTGATGCAGCGTCAGCTCTTCCTGCATCAC
TACTTCCCGGCCCTGTACTTCGCCGTCGTCGCCCTCTGTCAGATGTTTGACTATCTCACCGTTCGTATCCCCGGC
GTCGGGGCCCGGGACGGGGCCGTCGTCAATAAGGCTGCCACCGTCTGCTTCCTCGCGCTGTCTGCCGCTGCCTTT
AGCCTCTACGCTCCTCTGGCGTACGGTAATCACTGGACAAGGGGCGAGTGCAGCCGGGTCAAGGTTCTCAGCACG
TGGGACTGGGACTGCAACAACTTTTACGATTCGTACGAGGCCTATTCGTCCGAGGGCTCCTTCGCCAGTCCGCCC
GCGGCCTCGACGACGGCGGCCAAGAAGTCCGCCGAGAAGGTGGCAGCCGAAATATCGTCGCCCTCGCCGCCGCCC
GGCCCCCGCGCTGTATCTCTTGAAGAGTCTGTCGAGTACCGCGATCAGGACGGCAACCTCCTCAACGCGGAGCAG
GTAGAAAAGCTCAAGGGCAAGGTCGACTTCCAGACGCTCTACGAGACACGCACCCGCGTCCTCGACGAGCAAGGC
AACGAACTCCCAATGCCAGAAGGTGGCTGGCCCGCCGACATCGACGCCGGCGTCGCGCCCCCGCACCCCGACGTA
GAGGGCGTCGACAAGGAGACGGTAAAGGCAGGGGGCGCCGAACCGCCTAGGCATGCGGCGGCCAGTCGTGATGGC
GAGAGGGAGGCTGAGCGGGCGAGGGCTAAGCCTGGGAGTGAGGGGAAGGATGCGACGGTCAGGGATGAGCTTTAG
Transcript >Ophcf2|03020
ATGGCCAAGACCACCGCCAGCGGCGGCAAAAGCCCTCCGTTACCGGGCCGCTCCTCTCCGCCACCGAGGGTCAAG
GCCAAGAAGAACGTATCGTACCAGTCGGACGGAGTCGAGGATCACGATGTCTTCCTGTTGCCCGTGTCCGACTAC
GTCGTCACCCTCTGCATCACCGTCCTGGCCACCATCGTCCGTATATTTAGGATCTACCAGCCTTCGAGCGTTGTC
TTCGATGAGGTCCATTTCGGAGGCTTCGCGTCCAAGTACATCAAGGGCAAGTTCTTCATGGACGTCCACCCGCCC
CTCGCCAAGATGCTCATCGCCCTCACCGGCTGGCTCGCTGGCTTTGACGGCAACTTCGACTTCAAGGACATTGGA
AAGGACTACCTCGAGCCCGGCGTGCCCTACGTAGCCATGCGCATGTTCCCGGCTGTGTGTGGCATCGCCTTGGCC
CCCTTCATGTTCCTCACCCTCAAGGCCATCGGATCCCGTACAATGACGGCCGCCATGGGCGCTTGTCTCATCATA
TTCGAAAACGGTCTTTTGACCCAGGCCCGCCTGATCCTCCTCGACTCGCCTCTTGTCGCCGCCACGGCCTTTACT
GTTCTCGCCTTCACCTGCTTCACCAACCAGCACGAGCAGGGCCCTGCCAAGGCCTTCAAGCCCGCCTGGTGGTTC
TGGCTGGCAATGACTGGTCTCGGTCTCGGCACCACCGTCAGCATCAAATGGGTCGGCCTCTTCACCATCGCCTGG
GTTGGCATCCTGACCCTGGTCCAACTATGGGTGCTTCTCGGCGACAATCGAAACGTCACCCTGCGACTCTGGGTG
AAGCATTTCATGGCTAGAATCTTCTGCCTCGTCATCATTCCCGTCACCTTCTACCTCGCCATGTTCGCCATACAC
TTCGTCTGCCTCGTCAACCCCGGCGACGGCGACGGCTTCATGAGCTCCGAGTTTCAAGCGACGCTCAACAGCAAG
GGCATGAAGGACGTGGCCGCCGACGTGGTGCTGGGCAGCCGCATCACCATGCGTCACGTCAACACTCAGGGCGGC
TACCTTCATTCGCATCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACGCTGTATCCGCACAAAGAC
GAGAACAACGTCTGGCTCATCGAGAACCAGACGCAGCCGCTGGGTTCCGATGGCCAACCCATCAACGGCACGCTG
GCTTGGGATCAGCTACCCGACGGGCCGAACTACGTGACCAATGGCATGGTCATCCGGCTCTATCACCAGCCGACA
CACAGGCGACTGCATTCGCACGACGTGCGGCCGCCCATCACCGAGGCCGAGTGGCAGAACGAGGTGTCGGCCTAT
GGCTTCGACGGTTTCGAGGGCGATGCCAACGATCTGTTCCGCGTCGAGATTGTCAAGAAGAAGTCGTCGGGCGCC
GTGGCCAAGGAGCGGCTCCGCACCATCGAGACCAAGTTCAGGCTCATCCACATCATGTCCGGTTGCGTCCTCTTC
TCCCACAAGGTGAAGCTCCCCGACTGGGCCTCGGAGCAGCAGGAGGTGACGTGCGCTCGAAGCGGGTCGCTGCCC
AACAGCCTGTGGTACGTGGAATACAACGAGCACCCTCAGCTGGGCGAGGGAGTCGAAAAGGTCAACTATCGCAAC
CCGGGCTTCCTCGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCCGGCCTCGTCGAGTCTCAC
GCCTGGGATTCGCGGCCCGGCTCGTGGCCGATCCTGCGACGCGGCATCAACTTCTGGGGCAAGCACCATACGCAG
ATCTATCTGATCGGCAACCCCATCGTCTGGTGGTCGTCGACGCTGGCTGTCGTTGTCTGGGTCATGTTCAAGGCC
GTCGCCGTCCTCCGGTGGCAGCGCAGTTGCAACGACTACTCGAGCGCCACCTTTAAGCGCTTCGACTATGAGATA
GGCACCTACGTGCTCGGCTGGATGCTGCACTATTTCCCCTTTTACCTGATGCAGCGTCAGCTCTTCCTGCATCAC
TACTTCCCGGCCCTGTACTTCGCCGTCGTCGCCCTCTGTCAGATGTTTGACTATCTCACCGTTCGTATCCCCGGC
GTCGGGGCCCGGGACGGGGCCGTCGTCAATAAGGCTGCCACCGTCTGCTTCCTCGCGCTGTCTGCCGCTGCCTTT
AGCCTCTACGCTCCTCTGGCGTACGGTAATCACTGGACAAGGGGCGAGTGCAGCCGGGTCAAGGTTCTCAGCACG
TGGGACTGGGACTGCAACAACTTTTACGATTCGTACGAGGCCTATTCGTCCGAGGGCTCCTTCGCCAGTCCGCCC
GCGGCCTCGACGACGGCGGCCAAGAAGTCCGCCGAGAAGGTGGCAGCCGAAATATCGTCGCCCTCGCCGCCGCCC
GGCCCCCGCGCTGTATCTCTTGAAGAGTCTGTCGAGTACCGCGATCAGGACGGCAACCTCCTCAACGCGGAGCAG
GTAGAAAAGCTCAAGGGCAAGGTCGACTTCCAGACGCTCTACGAGACACGCACCCGCGTCCTCGACGAGCAAGGC
AACGAACTCCCAATGCCAGAAGGTGGCTGGCCCGCCGACATCGACGCCGGCGTCGCGCCCCCGCACCCCGACGTA
GAGGGCGTCGACAAGGAGACGGTAAAGGCAGGGGGCGCCGAACCGCCTAGGCATGCGGCGGCCAGTCGTGATGGC
GAGAGGGAGGCTGAGCGGGCGAGGGCTAAGCCTGGGAGTGAGGGGAAGGATGCGACGGTCAGGGATGAGCTTTAG
Gene >Ophcf2|03020
ATGGCCAAGACCACCGCCAGCGGCGGCAAAAGCCCTCCGTTACCGGGCCGCTCCTCTCCGCCACCGAGGGTCAAG
GCCAAGAAGAACGTATCGTACCAGTCGGACGGAGTCGAGGATCACGATGTCTTCCTGTTGCCCGTGTCCGACTAC
GTCGTCACCCTCTGCATCACCGTCCTGGCCACCATCGTCCGTATATTTAGGATCTACCAGCCTTCGAGCGTTGTC
TTCGATGAGGTCCAGTGCGTACGGTCGCTCCCCTTGGCTCTTTGTCGCTGACCGCGTCGCAGTTTCGGAGGCTTC
GCGTCCAAGTACATCAAGGGCAAGTTCTTCATGGACGTCCACCCGCCCCTCGCCAAGATGCTCATCGCCCTCACC
GGCTGGCTCGCTGGCTTTGACGGCAACTTCGACTTCAAGGACATTGGAAAGGACTACCTCGAGCCCGGCGTGCCC
TACGTAGCCATGCGCATGTTCCCGGCTGTGTGTGGCATCGCCTTGGCCCCCTTCATGTTCCTCACCCTCAAGGCC
ATCGGATCCCGTACAATGACGGCCGCCATGGGCGCTTGTCTCATCATATTCGGTGCGTTTCGTGCCGACAATGCC
TGAGATGTTGTCTAATATCGAGTATGCAGAAAACGGTCTTTTGACCCAGGCCCGCCTGATCCTCCTCGACTCGCC
TCTTGTCGCCGCCACGGCCTTTACTGTTCTCGCCTTCACCTGCTTCACCAACCAGCACGAGCAGGGCCCTGCCAA
GGCCTTCAAGCCCGCCTGGTGGTTCTGGCTGGCAATGACTGGTCTCGGTCTCGGCACCACCGTCAGCATCAAATG
GGTCGGCCTCTTCACCATCGCCTGGGTTGGCATCCTGACCCTGGTCCAACTATGGGTGCTTCTCGGCGACAATCG
AAACGTCACCCTGGTAAGCCCGTTGTCGCTCCTCATCTGCCCCGTGATACCGGTCTAACGTGTGCGCAGCGACTC
TGGGTGAAGCATTTCATGGCTAGAATCTTCTGCCTCGTCATCATTCCCGTCACCTTCTACCTCGCCATGTTCGCC
ATACACTTCGTCTGCCTCGTCAACCCCGGCGACGGCGACGGCTTCATGAGCTCCGAGTTTCAAGCGACGCTCAAC
AGCAAGGGCATGAAGGACGTGGCCGCCGACGTGGTGCTGGGCAGCCGCATCACCATGCGTCACGTCAACACTCAG
GGCGGCTACCTTCATTCGCATCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACGCTGTATCCGCAC
AAAGACGAGAACAACGTCTGGCTCATCGAGAACCAGACGCAGCCGCTGGGTTCCGATGGCCAACCCATCAACGGC
ACGCTGGCTTGGGATCAGCTACCCGACGGGCCGAACTACGTGACCAATGGCATGGTCATCCGGCTCTATCACCAG
CCGACACACAGGCGACTGCATTCGCACGACGTGCGGCCGCCCATCACCGAGGCCGAGTGGCAGAACGAGGTGTCG
GCCTATGGCTTCGACGGTTTCGAGGGCGATGCCAACGATCTGTTCCGCGTCGAGATTGTCAAGAAGAAGTCGTCG
GGCGCCGTGGCCAAGGAGCGGCTCCGCACCATCGAGACCAAGTTCAGGCTCATCCACATCATGTCCGGTTGCGTC
CTCTTCTCCCACAAGGTGAAGCTCCCCGACTGGGCCTCGGAGCAGCAGGAGGTGACGTGCGCTCGAAGCGGGTCG
CTGCCCAACAGCCTGTGGTACGTGGAATACAACGAGCACCCTCAGCTGGGCGAGGGAGTCGAAAAGGTCAACTAT
CGCAACCCGGGCTTCCTCGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCCGGCCTCGTCGAG
TCTCACGCCTGGGATTCGCGGCCCGGCTCGTGGCCGATCCTGCGACGCGGCATCAACTTCTGGGGCAAGCACCAT
ACGCAGATCTATCTGATCGGCAACCCCATCGTCTGGTGGTCGTCGACGCTGGCTGTCGTTGTCTGGGTCATGTTC
AAGGCCGTCGCCGTCCTCCGGTGGCAGCGCAGTTGCAACGACTACTCGAGCGCCACCTTTAAGCGCTTCGACTAT
GAGATAGGCACCTACGTGCTCGGCTGGATGCTGCACTATTTCCCCTTTTACCTGATGCAGCGTCAGCTCTTCCTG
CATCACTACTTCCCGGCCCTGTACTTCGCCGTCGTCGCCCTCTGTCAGATGTTTGACTATCTCACCGTTCGTATC
CCCGGCGTCGGGGCCCGGGACGGGGCCGTCGTCAATAAGGCTGCCACCGTCTGCTTCCTCGCGCTGTCTGCCGCT
GCCTTTAGCCTCTACGCTCCTCTGGCGTACGGTAATCACTGGACAAGGGGCGAGTGCAGCCGGGTCAAGGTTCTC
AGCACGTGGGACTGGGACTGCAACAACTTTTACGATTCGGTGAGTGCTCATAGCTCGCCCGTCGTCTGCCGCGCT
GATTCCCGTTTAGTACGAGGCCTATTCGTCCGAGGGCTCCTTCGCCAGTCCGCCCGCGGCCTCGACGACGGCGGC
CAAGAAGTCCGCCGAGAAGGTGGCAGCCGAAATATCGTCGCCCTCGCCGCCGCCCGGCCCCCGCGCTGTATCTCT
TGAAGAGTCTGTCGAGTACCGCGATCAGGACGGCAACCTCCTCAACGCGGAGCAGGTAGAAAAGCTCAAGGGCAA
GGTCGACTTCCAGACGCTCTACGAGACACGCACCCGCGTCCTCGACGAGCAAGGCAACGAACTCCCAATGCCAGA
AGGTGGCTGGCCCGCCGACATCGACGCCGGCGTCGCGCCCCCGCACCCCGACGTAGAGGGCGTCGACAAGGAGAC
GGTAAAGGCAGGGGGCGCCGAACCGCCTAGGCATGCGGCGGCCAGTCGTGATGGCGAGAGGGAGGCTGAGCGGGC
GAGGGCTAAGCCTGGGAGTGAGGGGAAGGATGCGACGGTCAGGGATGAGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail