Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03019
Gene name
Locationscaffold_03:435894..437536
Strand-
Gene length (bp)1642
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12230 PRP21_like_P Pre-mRNA splicing factor PRP21 like protein 1.4E-52 204 457
PF01805 Surp Surp module 3.6E-19 32 82
PF01805 Surp Surp module 5.5E-14 129 179

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0003723 RNA binding Yes
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3133 0.8077 0.0196 0.092 0.0339 0.0009 0.0703 0.0269 0.0456 0.0071

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 96.40 54.52 138.29
Alive In ants, during behavior modification 90.68 51.32 130.04
Dead In ants, recently dead 104.37 58.65 150.08

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.795402 no
Alive Dead 0.426170 no
Dead Fungus 0.724239 no

Orthologs

Orthofinder run ID4
Orthogroup1736
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4245
Ophiocordyceps australis map64 (Brazil) OphauB2|732
Ophiocordyceps camponoti-floridani Ophcf2|03019 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3923
Ophiocordyceps kimflemingae Ophio5|2681
Ophiocordyceps subramaniannii Hirsu2|1593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03019
MAAAPTANGDASAALDNFQPPPNVVLPPREIRTVLEKTAGYVARNGAVFEDRIRDKESRNPKFSFLYPSDAYYNF
YQWRLSEIKAGRGTDIAAGRAGEVPKPEKPKGPPAPPELHYSAKMPRINQKDMDVLKLTAQFTAKFGRQWMTQLA
QREAGNPQFQFLIPNHTFHNFFQHVVEQYSKVLKHHETSKLREEMLSEARSNLAKQYRVLDRAKQRAEYAKYQET
EKQKREEEETKKKEDFARVDWSDFVVVETITFTDADETANLPPPTSLSELEYASLEDRNKASISANFRIEEAMPG
EDMETHQQPAHTLPPRPVSTPQQTAPDNQPAQFPVPEQKSAERLAMEAEEARRIQERAEAQARMQQAQAEARGGA
GPMKIKENYVPRAAQRAASKVQMALCPNCKQQIPMNELDEHMRIELLDPSWKEQKAKADSRYAHSNISHADVANN
LKRLASQRSDVFDPITGQAVSEDELARRKKTALPSFDGSPEAKSQMQSFNVEEQIKAIHQKFADKK*
Coding >Ophcf2|03019
ATGGCAGCGGCTCCCACGGCGAACGGCGATGCGTCCGCTGCGCTGGACAACTTCCAGCCTCCGCCAAACGTCGTC
TTACCACCGCGCGAAATCCGTACCGTCCTCGAGAAGACGGCTGGCTACGTGGCTCGGAACGGCGCCGTTTTCGAG
GACCGCATTCGCGACAAGGAAAGCCGAAATCCCAAGTTCAGCTTCCTCTACCCGTCCGACGCCTACTACAACTTC
TATCAATGGCGTCTCAGCGAGATCAAAGCCGGTCGCGGCACCGACATCGCCGCTGGCCGGGCCGGCGAGGTGCCC
AAGCCCGAGAAGCCCAAGGGACCGCCGGCTCCGCCCGAGCTGCACTATTCGGCCAAGATGCCGCGCATCAACCAG
AAAGACATGGACGTGCTCAAGCTCACGGCGCAATTTACGGCCAAGTTTGGGCGTCAGTGGATGACGCAGCTGGCC
CAGCGTGAGGCGGGCAACCCGCAGTTCCAGTTCCTCATTCCCAATCACACCTTTCACAATTTCTTCCAGCACGTG
GTAGAGCAGTACTCCAAAGTGCTAAAGCATCACGAAACCTCGAAGCTACGAGAGGAGATGCTTTCCGAGGCGCGC
AGCAACCTTGCCAAGCAGTACCGCGTCCTCGACCGGGCCAAGCAGCGAGCCGAATACGCCAAGTACCAGGAGACG
GAGAAGCAGAAGAGGGAAGAGGAAGAAACGAAGAAGAAGGAAGATTTCGCGCGCGTCGACTGGAGCGATTTCGTC
GTCGTCGAGACCATCACCTTTACCGACGCCGACGAGACGGCCAACCTGCCGCCGCCCACCAGCCTATCGGAGCTC
GAGTACGCGTCTCTGGAGGACAGGAACAAGGCGTCCATCAGCGCCAACTTTCGCATCGAGGAGGCCATGCCAGGG
GAAGACATGGAGACGCACCAGCAGCCAGCCCACACACTTCCGCCGCGCCCCGTGTCCACGCCGCAGCAGACGGCG
CCGGACAATCAGCCGGCCCAGTTCCCGGTTCCGGAGCAGAAATCGGCAGAGAGGCTGGCTATGGAGGCGGAGGAG
GCGCGACGCATTCAGGAGAGAGCGGAGGCGCAGGCTCGGATGCAGCAAGCACAGGCGGAAGCCAGAGGCGGCGCA
GGACCGATGAAGATTAAAGAAAACTACGTTCCCCGAGCGGCGCAGCGGGCAGCAAGCAAGGTCCAGATGGCACTC
TGTCCGAACTGCAAGCAGCAAATACCGATGAACGAGTTGGACGAGCACATGCGAATCGAGCTTCTGGATCCCAGC
TGGAAGGAACAAAAGGCCAAGGCAGATTCTCGCTACGCACACTCCAACATCTCCCACGCCGACGTGGCCAACAAC
TTGAAGAGGCTCGCCAGCCAGCGAAGTGACGTCTTCGACCCGATCACAGGCCAAGCCGTAAGCGAAGACGAGCTC
GCGCGACGCAAGAAGACGGCATTACCCAGCTTCGACGGCAGCCCAGAGGCCAAGAGCCAGATGCAGAGCTTCAAC
GTGGAGGAGCAGATCAAGGCGATCCACCAAAAGTTCGCGGACAAGAAGTGA
Transcript >Ophcf2|03019
ATGGCAGCGGCTCCCACGGCGAACGGCGATGCGTCCGCTGCGCTGGACAACTTCCAGCCTCCGCCAAACGTCGTC
TTACCACCGCGCGAAATCCGTACCGTCCTCGAGAAGACGGCTGGCTACGTGGCTCGGAACGGCGCCGTTTTCGAG
GACCGCATTCGCGACAAGGAAAGCCGAAATCCCAAGTTCAGCTTCCTCTACCCGTCCGACGCCTACTACAACTTC
TATCAATGGCGTCTCAGCGAGATCAAAGCCGGTCGCGGCACCGACATCGCCGCTGGCCGGGCCGGCGAGGTGCCC
AAGCCCGAGAAGCCCAAGGGACCGCCGGCTCCGCCCGAGCTGCACTATTCGGCCAAGATGCCGCGCATCAACCAG
AAAGACATGGACGTGCTCAAGCTCACGGCGCAATTTACGGCCAAGTTTGGGCGTCAGTGGATGACGCAGCTGGCC
CAGCGTGAGGCGGGCAACCCGCAGTTCCAGTTCCTCATTCCCAATCACACCTTTCACAATTTCTTCCAGCACGTG
GTAGAGCAGTACTCCAAAGTGCTAAAGCATCACGAAACCTCGAAGCTACGAGAGGAGATGCTTTCCGAGGCGCGC
AGCAACCTTGCCAAGCAGTACCGCGTCCTCGACCGGGCCAAGCAGCGAGCCGAATACGCCAAGTACCAGGAGACG
GAGAAGCAGAAGAGGGAAGAGGAAGAAACGAAGAAGAAGGAAGATTTCGCGCGCGTCGACTGGAGCGATTTCGTC
GTCGTCGAGACCATCACCTTTACCGACGCCGACGAGACGGCCAACCTGCCGCCGCCCACCAGCCTATCGGAGCTC
GAGTACGCGTCTCTGGAGGACAGGAACAAGGCGTCCATCAGCGCCAACTTTCGCATCGAGGAGGCCATGCCAGGG
GAAGACATGGAGACGCACCAGCAGCCAGCCCACACACTTCCGCCGCGCCCCGTGTCCACGCCGCAGCAGACGGCG
CCGGACAATCAGCCGGCCCAGTTCCCGGTTCCGGAGCAGAAATCGGCAGAGAGGCTGGCTATGGAGGCGGAGGAG
GCGCGACGCATTCAGGAGAGAGCGGAGGCGCAGGCTCGGATGCAGCAAGCACAGGCGGAAGCCAGAGGCGGCGCA
GGACCGATGAAGATTAAAGAAAACTACGTTCCCCGAGCGGCGCAGCGGGCAGCAAGCAAGGTCCAGATGGCACTC
TGTCCGAACTGCAAGCAGCAAATACCGATGAACGAGTTGGACGAGCACATGCGAATCGAGCTTCTGGATCCCAGC
TGGAAGGAACAAAAGGCCAAGGCAGATTCTCGCTACGCACACTCCAACATCTCCCACGCCGACGTGGCCAACAAC
TTGAAGAGGCTCGCCAGCCAGCGAAGTGACGTCTTCGACCCGATCACAGGCCAAGCCGTAAGCGAAGACGAGCTC
GCGCGACGCAAGAAGACGGCATTACCCAGCTTCGACGGCAGCCCAGAGGCCAAGAGCCAGATGCAGAGCTTCAAC
GTGGAGGAGCAGATCAAGGCGATCCACCAAAAGTTCGCGGACAAGAAGTGA
Gene >Ophcf2|03019
ATGGCAGCGGCTCCCACGGCGAACGGCGATGCGTCCGCTGCGCTGGACAACTTCCAGCCTCCGCCAAACGTCGTC
TTACCACCGCGCGAAATCCGTACCGTCCTCGAGAAGACGGCTGGCTACGTGGCTCGGAACGGCGCCGTTTTCGAG
GACCGCATTCGCGACAAGGAAAGCCGAAATCCCAAGTTCAGCTTCCTCTACCCGTCCGACGCCTACTACAACTTC
TATCAATGGCGTCTCAGCGAGATCAAAGCCGGTCGCGGCACCGACATCGCCGCTGGCCGGGCCGGCGAGGTGCCC
AAGCCCGAGAAGCCCAAGGGACCGCCGGCTCCGCCCGAGCTGCACTATTCGGCCAAGATGCCGCGCATCAACCAG
AAAGACATGGACGTGCTCAAGCTCACGGCGCAATTTACGGCCAAGTTTGGGCGTCAGTGGATGACGCAGCTGGCC
CAGCGTGAGGCGGGCAACCCGCAGTTCCAGTTCCTCATTCCCAATCACACCTTTCACAATTTCTTCCAGCACGTG
GTAGAGCAGTACTCCAAAGTGCTAAAGCATCACGAAACCTCGAAGCTACGAGAGGAGATGCTTTCCGAGGCGCGC
AGCAACCTTGCCAAGCAGTACCGCGTCCTCGACCGGGCCAAGCAGCGAGCCGAATACGCCAAGTACCAGGAGACG
GAGAAGCAGAAGAGGGAAGAGGAAGAAACGAAGAAGAAGGAAGATTTCGCGCGCGTCGACTGGAGCGATTTCGTC
GTCGTCGAGACCATCACCTTTACCGACGCCGACGAGACGGCCAACCTGCCGCCGCCCACCAGCCTATCGGAGCTC
GAGTACGCGTCTCTGGAGGACAGGAACAAGGCGTCCATCAGCGCCAACTTTCGCATCGAGGAGGCCATGCCAGGG
GAAGACATGGAGACGCACCAGCAGCCAGCCCACACACTTCCGCCGCGCCCCGTGTCCACGCCGCAGCAGACGGCG
CCGGACAATCAGCCGGCCCAGTTCCCGGTTCCGGAGCAGAAATCGGCAGAGAGGCTGGCTATGGAGGCGGAGGAG
GCGCGACGCATTCAGGAGAGAGCGGAGGCGCAGGCTCGGATGCAGCAAGCACAGGCGGAAGCCAGAGGCGGCGCA
GGACCGATGAAGATTAAAGAAAACTACGTTCCCCGAGCGGCGCAGCGGGCAGCAAGCAAGGTCCAGATGGCACTC
TGTCCGAACTGCAAGCAGCAAATACCGATGAACGAGTTGGACGAGCACATGCGAAGTAAAGCCTCTCCCCCCCCC
CCCCTTCACCAATCCAATCTCCCTCGGTTCAAGGCAGTCTGTTGCGAGGATGATGAGCTAACGCATGACAGTCGA
GCTTCTGGATCCCAGCTGGAAGGAACAAAAGGCCAAGGCAGATTCTCGCTACGCACACTCCAACATCTCCCACGC
CGACGTGGCCAACAACTTGAAGAGGCTCGCCAGCCAGCGAAGTGACGTCTTCGACCCGATCACAGGCCAAGCCGT
AAGCGAAGACGAGCTCGCGCGACGCAAGAAGACGGCATTACCCAGCTTCGACGGCAGCCCAGAGGCCAAGAGCCA
GATGCAGAGCTTCAACGTGGAGGAGCAGATCAAGGCGATCCACCAAAAGTTCGCGGACAAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail