Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03017
Gene name
Locationscaffold_03:433080..434259
Strand-
Gene length (bp)1179
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 1.9E-21 97 286

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5141 0.4885 0.0398 0.0314 0.1444 0.1293 0.1914 0.0723 0.0865 0.101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4242
Ophiocordyceps australis map64 (Brazil) OphauB2|729
Ophiocordyceps camponoti-floridani Ophcf2|03017 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3921
Ophiocordyceps kimflemingae Ophio5|2679
Ophiocordyceps subramaniannii Hirsu2|3353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03017
MTEELAISLGGTRLFQAQDPPSITSLEALCSRTTKPEEYPLASTIQDNIPIYKLPPFTTTTPSYRAALQDEWYRI
LLHGPGVLVIKSLFTDVKLINRVTTVFNTIISREASSHRGDHFSNTSPNARIWNALGKHALSDPPSFISYYSNPY
LSLVAESWLGPCYRLTAQVNNVRPGSEAQVCHRDYHLGFMTDTQCAQYPRATHLASQFLTLQGAVAHVDMPAASG
PTRLLPYSQILAAGYLAYRLRPFIDFFDDHHVALPLNQGDGLFFNPALMHAAGQNNSPTDRLANLLQISSPLGKP
MEAVDAIPLVDTCWELLLKHYGEGKHHEVRAVVAAMAEGYPFPTNLDRNAPRGGSSMAPESEREVLWACLGEGSE
KELVLERLRDLRRASRA*
Coding >Ophcf2|03017
ATGACAGAAGAACTCGCCATCAGCCTCGGAGGAACGCGTCTCTTCCAAGCACAAGATCCCCCGTCCATCACCTCC
CTCGAAGCCCTCTGCTCACGCACCACAAAACCGGAAGAATATCCGCTAGCCAGCACCATCCAAGACAACATCCCC
ATCTACAAACTGCCCCCCTTCACCACGACCACTCCTTCGTACCGCGCCGCCCTCCAAGACGAATGGTACCGGATC
CTCCTTCACGGCCCCGGCGTCTTGGTCATAAAATCCCTCTTCACAGACGTCAAGCTCATCAACCGCGTCACCACC
GTCTTCAACACCATCATCTCTCGAGAAGCATCATCCCACCGAGGCGACCACTTCTCAAACACCAGCCCCAACGCC
CGAATCTGGAACGCGCTCGGAAAACACGCCCTCTCCGATCCCCCCTCCTTCATATCCTACTATTCAAACCCCTAC
CTCTCCCTCGTAGCCGAATCCTGGCTGGGACCCTGCTACCGCCTGACCGCACAGGTCAACAACGTCCGTCCGGGC
TCCGAAGCCCAAGTCTGCCACCGCGATTACCACCTCGGCTTCATGACCGATACGCAGTGCGCGCAATACCCGCGA
GCCACCCATCTTGCCAGCCAGTTCCTCACCCTGCAGGGGGCCGTTGCCCACGTCGACATGCCGGCTGCCAGCGGA
CCGACGCGTCTGCTTCCGTATAGCCAGATTCTGGCTGCCGGTTACCTCGCCTACCGACTGCGGCCATTCATCGAC
TTCTTCGATGACCATCACGTTGCGCTACCACTCAACCAAGGCGACGGCCTATTCTTCAACCCTGCCCTCATGCAC
GCAGCCGGCCAGAACAACTCTCCCACGGACAGACTAGCCAACCTGCTACAGATAAGCAGCCCACTAGGAAAACCC
ATGGAGGCAGTCGACGCCATCCCCCTGGTAGACACCTGCTGGGAACTCCTCCTGAAGCACTACGGGGAGGGAAAA
CACCACGAGGTTCGGGCCGTAGTAGCCGCCATGGCCGAGGGATATCCGTTCCCTACCAACCTGGATCGGAACGCG
CCGCGGGGGGGCAGCAGCATGGCGCCGGAGTCGGAGCGGGAGGTGCTCTGGGCATGTTTGGGGGAAGGGTCGGAG
AAGGAGCTTGTGTTGGAGAGGTTGAGGGACCTTCGGAGGGCTTCGAGGGCTTAG
Transcript >Ophcf2|03017
ATGACAGAAGAACTCGCCATCAGCCTCGGAGGAACGCGTCTCTTCCAAGCACAAGATCCCCCGTCCATCACCTCC
CTCGAAGCCCTCTGCTCACGCACCACAAAACCGGAAGAATATCCGCTAGCCAGCACCATCCAAGACAACATCCCC
ATCTACAAACTGCCCCCCTTCACCACGACCACTCCTTCGTACCGCGCCGCCCTCCAAGACGAATGGTACCGGATC
CTCCTTCACGGCCCCGGCGTCTTGGTCATAAAATCCCTCTTCACAGACGTCAAGCTCATCAACCGCGTCACCACC
GTCTTCAACACCATCATCTCTCGAGAAGCATCATCCCACCGAGGCGACCACTTCTCAAACACCAGCCCCAACGCC
CGAATCTGGAACGCGCTCGGAAAACACGCCCTCTCCGATCCCCCCTCCTTCATATCCTACTATTCAAACCCCTAC
CTCTCCCTCGTAGCCGAATCCTGGCTGGGACCCTGCTACCGCCTGACCGCACAGGTCAACAACGTCCGTCCGGGC
TCCGAAGCCCAAGTCTGCCACCGCGATTACCACCTCGGCTTCATGACCGATACGCAGTGCGCGCAATACCCGCGA
GCCACCCATCTTGCCAGCCAGTTCCTCACCCTGCAGGGGGCCGTTGCCCACGTCGACATGCCGGCTGCCAGCGGA
CCGACGCGTCTGCTTCCGTATAGCCAGATTCTGGCTGCCGGTTACCTCGCCTACCGACTGCGGCCATTCATCGAC
TTCTTCGATGACCATCACGTTGCGCTACCACTCAACCAAGGCGACGGCCTATTCTTCAACCCTGCCCTCATGCAC
GCAGCCGGCCAGAACAACTCTCCCACGGACAGACTAGCCAACCTGCTACAGATAAGCAGCCCACTAGGAAAACCC
ATGGAGGCAGTCGACGCCATCCCCCTGGTAGACACCTGCTGGGAACTCCTCCTGAAGCACTACGGGGAGGGAAAA
CACCACGAGGTTCGGGCCGTAGTAGCCGCCATGGCCGAGGGATATCCGTTCCCTACCAACCTGGATCGGAACGCG
CCGCGGGGGGGCAGCAGCATGGCGCCGGAGTCGGAGCGGGAGGTGCTCTGGGCATGTTTGGGGGAAGGGTCGGAG
AAGGAGCTTGTGTTGGAGAGGTTGAGGGACCTTCGGAGGGCTTCGAGGGCTTAG
Gene >Ophcf2|03017
ATGACAGAAGAACTCGCCATCAGCCTCGGAGGAACGCGTCTCTTCCAAGCACAAGATCCCCCGTCCATCACCTCC
CTCGAAGCCCTCTGCTCACGCACCACAAAACCGGAAGAATATCCGCTAGCCAGCACCATCCAAGACAACATCCCC
ATCTACAAACTGCCCCCCTTCACCACGACCACTCCTTCGTACCGCGCCGCCCTCCAAGACGAATGGTACCGGATC
CTCCTTCACGGCCCCGGCGTCTTGGTCATAAAATCCCTCTTCACAGACGTCAAGCTCATCAACCGCGTCACCACC
GTCTTCAACACCATCATCTCTCGAGAAGCATCATCCCACCGAGGCGACCACTTCTCAAACACCAGCCCCAACGCC
CGAATCTGGAACGCGCTCGGAAAACACGCCCTCTCCGATCCCCCCTCCTTCATATCCTACTATTCAAACCCCTAC
CTCTCCCTCGTAGCCGAATCCTGGCTGGGACCCTGCTACCGCCTGACCGCACAGGTCAACAACGTCCGTCCGGGC
TCCGAAGCCCAAGTCTGCCACCGCGATTACCACCTCGGCTTCATGACCGATACGCAGTGCGCGCAATACCCGCGA
GCCACCCATCTTGCCAGCCAGTTCCTCACCCTGCAGGGGGCCGTTGCCCACGTCGACATGCCGGCTGCCAGCGGA
CCGACGCGTCTGCTTCCGTATAGCCAGATTCTGGCTGCCGGTTACCTCGCCTACCGACTGCGGCCATTCATCGAC
TTCTTCGATGACCATCACGTTGCGCTACCACTCAACCAAGGCGACGGCCTATTCTTCAACCCTGCCCTCATGCAC
GCAGCCGGCCAGAACAACTCTCCCACGGACAGACTAGCCAACCTGCTACAGATAAGCAGCCCACTAGGAAAACCC
ATGGAGGCAGTCGACGCCATCCCCCTGGTAGACACCTGCTGGGAACTCCTCCTGAAGCACTACGGGGAGGGAAAA
CACCACGAGGTTCGGGCCGTAGTAGCCGCCATGGCCGAGGGATATCCGTTCCCTACCAACCTGGATCGGAACGCG
CCGCGGGGGGGCAGCAGCATGGCGCCGGAGTCGGAGCGGGAGGTGCTCTGGGCATGTTTGGGGGAAGGGTCGGAG
AAGGAGCTTGTGTTGGAGAGGTTGAGGGACCTTCGGAGGGCTTCGAGGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail