Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03014
Gene name
Locationscaffold_03:426660..426991
Strand+
Gene length (bp)331
Transcript length (bp)276
Coding sequence length (bp)276
Protein length (aa) 92

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 47 66 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 41.48 8.86 74.10
Alive In ants, during behavior modification 89.02 21.10 156.93
Dead In ants, recently dead 94.31 27.07 161.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.021210 yes
Alive Dead 0.871629 no
Dead Fungus 0.011890 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03014
MSALRLAARPIATLYPRRLLPTTRFYSEAPRTQDSPAQATAVKSQRSVAAIGAIGIGLGACFFFLLSRPGKAGDA
IAGPRPAAEISEQRSR*
Coding >Ophcf2|03014
ATGTCCGCCCTCCGCCTCGCAGCTAGACCGATAGCTACCCTATACCCCCGCCGTCTCCTCCCCACCACACGCTTC
TACTCGGAAGCGCCCCGAACGCAGGATTCTCCGGCCCAGGCAACAGCCGTCAAGAGCCAACGCTCCGTCGCCGCC
ATCGGTGCCATCGGTATCGGACTCGGCGCTTGCTTCTTCTTCCTTCTCAGCCGTCCCGGTAAGGCGGGCGACGCC
ATTGCCGGACCCCGGCCCGCCGCCGAGATTTCCGAGCAGCGGTCGAGGTAG
Transcript >Ophcf2|03014
ATGTCCGCCCTCCGCCTCGCAGCTAGACCGATAGCTACCCTATACCCCCGCCGTCTCCTCCCCACCACACGCTTC
TACTCGGAAGCGCCCCGAACGCAGGATTCTCCGGCCCAGGCAACAGCCGTCAAGAGCCAACGCTCCGTCGCCGCC
ATCGGTGCCATCGGTATCGGACTCGGCGCTTGCTTCTTCTTCCTTCTCAGCCGTCCCGGTAAGGCGGGCGACGCC
ATTGCCGGACCCCGGCCCGCCGCCGAGATTTCCGAGCAGCGGTCGAGGTAG
Gene >Ophcf2|03014
ATGTCCGCCCTCCGCCTCGCAGCTAGACCGATAGCTACCCTATACCCCCGCCGTCTCCTCCCCACCACACGCTTC
TACTCGGAAGCGCCCCGAACGCAGGATTCTCCGGCCCAGGCAACAGCCGTCAAGAGCCAGTGAGTCCCGCAACAC
GCCTGAGAAGCAAGATGCTGACATTGTTCCTCTCCGAAGACGCTCCGTCGCCGCCATCGGTGCCATCGGTATCGG
ACTCGGCGCTTGCTTCTTCTTCCTTCTCAGCCGTCCCGGTAAGGCGGGCGACGCCATTGCCGGACCCCGGCCCGC
CGCCGAGATTTCCGAGCAGCGGTCGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail