Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03002
Gene name
Locationscaffold_03:369986..370626
Strand+
Gene length (bp)640
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09747 CCD97-like_C Coiled-coil domain containing protein 97-like, C-terminal 1.7E-08 31 78
PF09747 CCD97-like_C Coiled-coil domain containing protein 97-like, C-terminal 1.6E-13 105 168

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5383 0.7901 0.0119 0.0119 0.2894 0.0021 0.0667 0.0424 0.0251 0.0369

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4400
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|459
Ophiocordyceps australis map64 (Brazil) OphauB2|4822
Ophiocordyceps camponoti-floridani Ophcf2|03002 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1246
Ophiocordyceps kimflemingae Ophio5|4339
Ophiocordyceps subramaniannii Hirsu2|911

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03002
MDARLTGPSFEKPTPLPPKTDAQKASIVIRNRRREYLERHPSYLDDPDHELADALLYERLITRFQTEQERDAQDL
AKGYDNVVQAHAARTQAPSSHPARTWDASLDAEDPHVVHVADRDHGRRLWRDFIRDRFLAGADDDFHYPDVDNDQ
DLDVQAARDAQDEWFDDEEPAWHSQDDVVGNGFRPGETGVQDF*
Coding >Ophcf2|03002
ATGGACGCCCGCCTGACCGGCCCATCCTTCGAAAAGCCAACCCCCCTCCCTCCCAAGACGGACGCACAAAAGGCC
TCGATCGTCATCAGAAACCGTCGACGCGAGTATCTAGAGCGCCACCCGTCCTACCTCGATGATCCTGACCATGAG
CTTGCCGATGCTCTTCTCTACGAACGCCTCATCACTCGCTTCCAGACGGAACAAGAGCGCGACGCCCAGGATCTG
GCCAAAGGCTACGACAACGTCGTTCAAGCCCACGCTGCCCGCACCCAAGCTCCGAGCTCCCATCCCGCACGCACC
TGGGACGCCTCGCTAGACGCTGAAGATCCCCACGTCGTTCACGTCGCCGACAGGGACCACGGTCGTCGTCTCTGG
CGCGACTTCATCCGCGACCGCTTCCTCGCCGGCGCAGACGATGACTTTCACTACCCAGACGTCGACAACGACCAA
GACCTCGACGTCCAAGCTGCAAGAGATGCTCAGGACGAGTGGTTCGACGACGAGGAGCCTGCCTGGCACAGCCAA
GACGATGTCGTCGGCAACGGTTTTCGTCCAGGCGAGACGGGTGTCCAGGACTTTTGA
Transcript >Ophcf2|03002
ATGGACGCCCGCCTGACCGGCCCATCCTTCGAAAAGCCAACCCCCCTCCCTCCCAAGACGGACGCACAAAAGGCC
TCGATCGTCATCAGAAACCGTCGACGCGAGTATCTAGAGCGCCACCCGTCCTACCTCGATGATCCTGACCATGAG
CTTGCCGATGCTCTTCTCTACGAACGCCTCATCACTCGCTTCCAGACGGAACAAGAGCGCGACGCCCAGGATCTG
GCCAAAGGCTACGACAACGTCGTTCAAGCCCACGCTGCCCGCACCCAAGCTCCGAGCTCCCATCCCGCACGCACC
TGGGACGCCTCGCTAGACGCTGAAGATCCCCACGTCGTTCACGTCGCCGACAGGGACCACGGTCGTCGTCTCTGG
CGCGACTTCATCCGCGACCGCTTCCTCGCCGGCGCAGACGATGACTTTCACTACCCAGACGTCGACAACGACCAA
GACCTCGACGTCCAAGCTGCAAGAGATGCTCAGGACGAGTGGTTCGACGACGAGGAGCCTGCCTGGCACAGCCAA
GACGATGTCGTCGGCAACGGTTTTCGTCCAGGCGAGACGGGTGTCCAGGACTTTTGA
Gene >Ophcf2|03002
ATGGACGCCCGCCTGACCGGCCCATCCTTCGAAAAGCCAACCCCCCTCCCTCCCAAGACGGACGCACAAAAGGCC
TCGATCGTCATCAGAAACCGTCGACGCGAGTATCTAGAGCGCCACCCGTCCTACCTCGATGATCCTGACCATGAG
CTTGCCGGTAAGCAATCATGGACGCTTAGGTAGCTCCTTTCCTGTATCTTAACCTTATCTCGCAGATGCTCTTCT
CTACGAACGCCTCATCACTCGCTTCCAGACGGAACAAGAGCGCGACGCCCAGGATCTGGCCAAAGGCTACGACAA
CGTCGTTCAAGCCCACGCTGCCCGCACCCAAGCTCCGAGCTCCCATCCCGCACGCACCTGGGACGCCTCGCTAGA
CGCTGAAGATCCCCACGTCGTTCACGTCGCCGACAGGGACCACGGTCGTCGTCTCTGGCGCGACTTCATCCGCGA
CCGCTTCCTCGCCGGCGCAGACGATGACTTTCACTACCCAGACGTCGACAACGACCAAGACCTCGACGTCCAAGC
TGCAAGAGATGCTCAGGACGAGTGGTTCGACGACGAGGAGCCTGCCTGGCACAGCCAAGACGATGTCGTCGGCAA
CGGTTTTCGTCCAGGCGAGACGGGTGTCCAGGACTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail