Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02993
Gene name
Locationscaffold_03:341989..343251
Strand-
Gene length (bp)1262
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 3.4E-19 8 213

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 39 61 22
3 81 103 22
4 116 135 19
5 155 174 19
6 186 208 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.02 0.0 0.14
Alive In ants, during behavior modification 0.80 0.0 1.75
Dead In ants, recently dead 1.89 0.0 4.04

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.175419 no
Alive Dead 0.059415 no
Dead Fungus 0.175419 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02993
MAIAVPTFIGSLLSFLATLVALGFHFYSPPRRHFRHALVINLLVADFINSLNNTISGAFVLSSKDQASVDDTPDV
ACIANAWIGQFSVQAVDFNILIISIIVLYTVLNSRLVSEPSTWATVGICIAAWIPGLITSELPERLHVLLYADDD
STAKGLLGLALGVYGYVSGNWCWIRAQHLGLRYGLTHGWRIAIFIGTIAIYTFIYVHLKRVFGRFRVSGPSTGNT
TSRDQTVIEHDFDNTDSQHILVSSSFAVSHELDDMSHTSSETIKNTSSTGKTAVWAVAASEAGPSDPAKSAYKRP
GAGGVSRPMSKLPAPPNLKKMLLMNGYPLAYIVLWLPGMINRLAESTGHSPRWLRALQSSTQFIGFVNAFTYGFS
EHLRRVHRHWSKKRDGRRDRS*
Coding >Ophcf2|02993
ATGGCCATTGCGGTGCCGACGTTTATTGGCTCTTTACTGTCGTTTCTTGCTACGCTTGTTGCCTTGGGGTTTCAC
TTTTACTCGCCTCCGAGACGGCACTTTCGACACGCTCTCGTCATCAACCTCCTCGTCGCCGATTTCATCAATAGT
TTAAACAACACCATCTCAGGCGCCTTCGTCCTCTCTTCCAAGGATCAGGCGTCCGTCGACGACACGCCGGACGTT
GCCTGCATAGCCAACGCCTGGATCGGGCAGTTTTCCGTCCAGGCTGTCGACTTCAACATCCTCATCATCTCCATC
ATCGTGCTCTACACCGTTCTCAACAGCAGGCTTGTTTCCGAGCCTTCGACGTGGGCGACGGTGGGCATCTGTATC
GCTGCTTGGATCCCGGGACTCATCACCAGTGAGCTTCCCGAAAGACTCCACGTGCTTCTCTACGCTGACGACGAC
TCAACCGCAAAAGGTCTCTTGGGTCTCGCGCTGGGCGTCTACGGATACGTCAGTGGAAACTGGTGCTGGATCCGA
GCTCAACATCTCGGGCTTCGTTACGGTCTCACGCACGGATGGCGTATTGCCATCTTTATCGGGACCATTGCCATC
TACACCTTCATCTATGTCCATCTCAAGCGCGTCTTTGGTCGTTTTCGCGTCAGCGGTCCTTCAACCGGAAACACC
ACGTCCCGAGATCAGACCGTGATAGAACATGATTTCGACAACACCGATTCGCAACACATTCTCGTCTCCAGCTCC
TTCGCAGTCTCCCACGAACTAGACGACATGTCACACACGAGCAGCGAAACCATCAAGAACACCAGCTCAACCGGC
AAGACAGCCGTCTGGGCCGTCGCCGCCTCCGAAGCCGGACCCTCCGATCCGGCAAAGTCGGCTTACAAGCGTCCC
GGAGCCGGAGGCGTCAGCAGACCAATGTCGAAGCTTCCCGCGCCGCCTAACCTCAAGAAGATGCTCCTGATGAAC
GGATACCCGCTCGCCTACATCGTTCTCTGGCTGCCCGGCATGATCAACCGGCTTGCCGAGTCTACGGGCCATTCG
CCGCGGTGGTTGCGTGCGCTACAGAGCTCTACGCAGTTCATAGGCTTTGTCAACGCTTTTACTTACGGATTCAGC
GAGCATCTTCGTCGTGTTCATCGGCATTGGTCCAAGAAGCGGGATGGGCGGCGAGACCGGTCTTGA
Transcript >Ophcf2|02993
ATGGCCATTGCGGTGCCGACGTTTATTGGCTCTTTACTGTCGTTTCTTGCTACGCTTGTTGCCTTGGGGTTTCAC
TTTTACTCGCCTCCGAGACGGCACTTTCGACACGCTCTCGTCATCAACCTCCTCGTCGCCGATTTCATCAATAGT
TTAAACAACACCATCTCAGGCGCCTTCGTCCTCTCTTCCAAGGATCAGGCGTCCGTCGACGACACGCCGGACGTT
GCCTGCATAGCCAACGCCTGGATCGGGCAGTTTTCCGTCCAGGCTGTCGACTTCAACATCCTCATCATCTCCATC
ATCGTGCTCTACACCGTTCTCAACAGCAGGCTTGTTTCCGAGCCTTCGACGTGGGCGACGGTGGGCATCTGTATC
GCTGCTTGGATCCCGGGACTCATCACCAGTGAGCTTCCCGAAAGACTCCACGTGCTTCTCTACGCTGACGACGAC
TCAACCGCAAAAGGTCTCTTGGGTCTCGCGCTGGGCGTCTACGGATACGTCAGTGGAAACTGGTGCTGGATCCGA
GCTCAACATCTCGGGCTTCGTTACGGTCTCACGCACGGATGGCGTATTGCCATCTTTATCGGGACCATTGCCATC
TACACCTTCATCTATGTCCATCTCAAGCGCGTCTTTGGTCGTTTTCGCGTCAGCGGTCCTTCAACCGGAAACACC
ACGTCCCGAGATCAGACCGTGATAGAACATGATTTCGACAACACCGATTCGCAACACATTCTCGTCTCCAGCTCC
TTCGCAGTCTCCCACGAACTAGACGACATGTCACACACGAGCAGCGAAACCATCAAGAACACCAGCTCAACCGGC
AAGACAGCCGTCTGGGCCGTCGCCGCCTCCGAAGCCGGACCCTCCGATCCGGCAAAGTCGGCTTACAAGCGTCCC
GGAGCCGGAGGCGTCAGCAGACCAATGTCGAAGCTTCCCGCGCCGCCTAACCTCAAGAAGATGCTCCTGATGAAC
GGATACCCGCTCGCCTACATCGTTCTCTGGCTGCCCGGCATGATCAACCGGCTTGCCGAGTCTACGGGCCATTCG
CCGCGGTGGTTGCGTGCGCTACAGAGCTCTACGCAGTTCATAGGCTTTGTCAACGCTTTTACTTACGGATTCAGC
GAGCATCTTCGTCGTGTTCATCGGCATTGGTCCAAGAAGCGGGATGGGCGGCGAGACCGGTCTTGA
Gene >Ophcf2|02993
ATGGCCATTGCGGTGCCGACGTTTATTGGCTCTTTACTGTCGTTTCTTGCTACGCTTGTTGCCTTGGGGTTTCAC
TTTTACTCGCCTCCGAGACGGCACTTTCGACACGCTCTCGTCATCAACCTCCTCGTCGCCGGTAGGAAGAAGCCG
TTTCTTTTGTTCTTACCAACGAGACGAGTGTCGTGCTTTGGCTGATGAGATGCAAAGATTTCATCAATAGTTTAA
ACAACACCATCTCAGGCGCCTTCGTCCTCTCTTCCAAGGATCAGGCGTCCGTCGACGACACGCCGGACGTTGCCT
GCATAGCCAACGCCTGGATCGGGCAGTTTTCCGTCCAGGCTGTCGACTTCAACATCCTCATCATCTCCATCATCG
TGCTCTACACCGTTCTCAACAGCAGGCTTGTTTCCGAGCCTTCGACGTGGGCGACGGTGGGCATCTGTATCGCTG
CTTGGATCCCGGGACTCATCACCAGTGAGCTTCCCGAAAGACTCCACGTGCTTCTCTACGCTGACGACGACTCAA
CCGCAAAAGGTCTCTTGGGTCTCGCGCTGGGCGTCTACGGATACGTCAGTGGAAACTGGTGCTGGATCCGAGCTC
AACATCTCGGGCTTCGTTACGGTCTCACGCACGGATGGCGTATTGCCATCTTTATCGGGACCATTGCCATCTACA
CCTTCATCTATGTCCATCTCAAGCGCGTCTTTGGTCGTTTTCGCGTCAGCGGTCCTTCAACCGGAAACACCACGT
CCCGAGATCAGACCGTGATAGAACATGATTTCGACAACACCGATTCGCAACACATTCTCGTCTCCAGCTCCTTCG
CAGTCTCCCACGAACTAGACGACATGTCACACACGAGCAGCGAAACCATCAAGAACACCAGCTCAACCGGCAAGA
CAGCCGTCTGGGCCGTCGCCGCCTCCGAAGCCGGACCCTCCGATCCGGCAAAGTCGGCTTACAAGCGTCCCGGAG
CCGGAGGCGTCAGCAGACCAATGTCGAAGCTTCCCGCGCCGCCTAACCTCAAGAAGATGCTCCTGATGAACGGAT
ACCCGCTCGCCTACATCGTTCTCTGGCTGCCCGGCATGATCAACCGGCTTGCCGAGTCTACGGGCCATTCGCCGC
GGTGGTTGCGTGCGCTACAGAGCTCTACGCAGTTCATAGGCTTTGTCAACGCTTTTACTTACGGATTCAGCGAGC
ATCTTCGTCGTGTTCATCGGCATTGGTCCAAGAAGCGGGATGGGCGGCGAGACCGGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail