Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02993
Gene name
Locationscaffold_03:341989..343251
Strand-
Gene length (bp)1262
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 3.4E-19 8 213

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 39 61 22
3 81 103 22
4 116 135 19
5 155 174 19
6 186 208 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02993
MAIAVPTFIGSLLSFLATLVALGFHFYSPPRRHFRHALVINLLVADFINSLNNTISGAFVLSSKDQASVDDTPDV
ACIANAWIGQFSVQAVDFNILIISIIVLYTVLNSRLVSEPSTWATVGICIAAWIPGLITSELPERLHVLLYADDD
STAKGLLGLALGVYGYVSGNWCWIRAQHLGLRYGLTHGWRIAIFIGTIAIYTFIYVHLKRVFGRFRVSGPSTGNT
TSRDQTVIEHDFDNTDSQHILVSSSFAVSHELDDMSHTSSETIKNTSSTGKTAVWAVAASEAGPSDPAKSAYKRP
GAGGVSRPMSKLPAPPNLKKMLLMNGYPLAYIVLWLPGMINRLAESTGHSPRWLRALQSSTQFIGFVNAFTYGFS
EHLRRVHRHWSKKRDGRRDRS*
Coding >Ophcf2|02993
ATGGCCATTGCGGTGCCGACGTTTATTGGCTCTTTACTGTCGTTTCTTGCTACGCTTGTTGCCTTGGGGTTTCAC
TTTTACTCGCCTCCGAGACGGCACTTTCGACACGCTCTCGTCATCAACCTCCTCGTCGCCGATTTCATCAATAGT
TTAAACAACACCATCTCAGGCGCCTTCGTCCTCTCTTCCAAGGATCAGGCGTCCGTCGACGACACGCCGGACGTT
GCCTGCATAGCCAACGCCTGGATCGGGCAGTTTTCCGTCCAGGCTGTCGACTTCAACATCCTCATCATCTCCATC
ATCGTGCTCTACACCGTTCTCAACAGCAGGCTTGTTTCCGAGCCTTCGACGTGGGCGACGGTGGGCATCTGTATC
GCTGCTTGGATCCCGGGACTCATCACCAGTGAGCTTCCCGAAAGACTCCACGTGCTTCTCTACGCTGACGACGAC
TCAACCGCAAAAGGTCTCTTGGGTCTCGCGCTGGGCGTCTACGGATACGTCAGTGGAAACTGGTGCTGGATCCGA
GCTCAACATCTCGGGCTTCGTTACGGTCTCACGCACGGATGGCGTATTGCCATCTTTATCGGGACCATTGCCATC
TACACCTTCATCTATGTCCATCTCAAGCGCGTCTTTGGTCGTTTTCGCGTCAGCGGTCCTTCAACCGGAAACACC
ACGTCCCGAGATCAGACCGTGATAGAACATGATTTCGACAACACCGATTCGCAACACATTCTCGTCTCCAGCTCC
TTCGCAGTCTCCCACGAACTAGACGACATGTCACACACGAGCAGCGAAACCATCAAGAACACCAGCTCAACCGGC
AAGACAGCCGTCTGGGCCGTCGCCGCCTCCGAAGCCGGACCCTCCGATCCGGCAAAGTCGGCTTACAAGCGTCCC
GGAGCCGGAGGCGTCAGCAGACCAATGTCGAAGCTTCCCGCGCCGCCTAACCTCAAGAAGATGCTCCTGATGAAC
GGATACCCGCTCGCCTACATCGTTCTCTGGCTGCCCGGCATGATCAACCGGCTTGCCGAGTCTACGGGCCATTCG
CCGCGGTGGTTGCGTGCGCTACAGAGCTCTACGCAGTTCATAGGCTTTGTCAACGCTTTTACTTACGGATTCAGC
GAGCATCTTCGTCGTGTTCATCGGCATTGGTCCAAGAAGCGGGATGGGCGGCGAGACCGGTCTTGA
Transcript >Ophcf2|02993
ATGGCCATTGCGGTGCCGACGTTTATTGGCTCTTTACTGTCGTTTCTTGCTACGCTTGTTGCCTTGGGGTTTCAC
TTTTACTCGCCTCCGAGACGGCACTTTCGACACGCTCTCGTCATCAACCTCCTCGTCGCCGATTTCATCAATAGT
TTAAACAACACCATCTCAGGCGCCTTCGTCCTCTCTTCCAAGGATCAGGCGTCCGTCGACGACACGCCGGACGTT
GCCTGCATAGCCAACGCCTGGATCGGGCAGTTTTCCGTCCAGGCTGTCGACTTCAACATCCTCATCATCTCCATC
ATCGTGCTCTACACCGTTCTCAACAGCAGGCTTGTTTCCGAGCCTTCGACGTGGGCGACGGTGGGCATCTGTATC
GCTGCTTGGATCCCGGGACTCATCACCAGTGAGCTTCCCGAAAGACTCCACGTGCTTCTCTACGCTGACGACGAC
TCAACCGCAAAAGGTCTCTTGGGTCTCGCGCTGGGCGTCTACGGATACGTCAGTGGAAACTGGTGCTGGATCCGA
GCTCAACATCTCGGGCTTCGTTACGGTCTCACGCACGGATGGCGTATTGCCATCTTTATCGGGACCATTGCCATC
TACACCTTCATCTATGTCCATCTCAAGCGCGTCTTTGGTCGTTTTCGCGTCAGCGGTCCTTCAACCGGAAACACC
ACGTCCCGAGATCAGACCGTGATAGAACATGATTTCGACAACACCGATTCGCAACACATTCTCGTCTCCAGCTCC
TTCGCAGTCTCCCACGAACTAGACGACATGTCACACACGAGCAGCGAAACCATCAAGAACACCAGCTCAACCGGC
AAGACAGCCGTCTGGGCCGTCGCCGCCTCCGAAGCCGGACCCTCCGATCCGGCAAAGTCGGCTTACAAGCGTCCC
GGAGCCGGAGGCGTCAGCAGACCAATGTCGAAGCTTCCCGCGCCGCCTAACCTCAAGAAGATGCTCCTGATGAAC
GGATACCCGCTCGCCTACATCGTTCTCTGGCTGCCCGGCATGATCAACCGGCTTGCCGAGTCTACGGGCCATTCG
CCGCGGTGGTTGCGTGCGCTACAGAGCTCTACGCAGTTCATAGGCTTTGTCAACGCTTTTACTTACGGATTCAGC
GAGCATCTTCGTCGTGTTCATCGGCATTGGTCCAAGAAGCGGGATGGGCGGCGAGACCGGTCTTGA
Gene >Ophcf2|02993
ATGGCCATTGCGGTGCCGACGTTTATTGGCTCTTTACTGTCGTTTCTTGCTACGCTTGTTGCCTTGGGGTTTCAC
TTTTACTCGCCTCCGAGACGGCACTTTCGACACGCTCTCGTCATCAACCTCCTCGTCGCCGGTAGGAAGAAGCCG
TTTCTTTTGTTCTTACCAACGAGACGAGTGTCGTGCTTTGGCTGATGAGATGCAAAGATTTCATCAATAGTTTAA
ACAACACCATCTCAGGCGCCTTCGTCCTCTCTTCCAAGGATCAGGCGTCCGTCGACGACACGCCGGACGTTGCCT
GCATAGCCAACGCCTGGATCGGGCAGTTTTCCGTCCAGGCTGTCGACTTCAACATCCTCATCATCTCCATCATCG
TGCTCTACACCGTTCTCAACAGCAGGCTTGTTTCCGAGCCTTCGACGTGGGCGACGGTGGGCATCTGTATCGCTG
CTTGGATCCCGGGACTCATCACCAGTGAGCTTCCCGAAAGACTCCACGTGCTTCTCTACGCTGACGACGACTCAA
CCGCAAAAGGTCTCTTGGGTCTCGCGCTGGGCGTCTACGGATACGTCAGTGGAAACTGGTGCTGGATCCGAGCTC
AACATCTCGGGCTTCGTTACGGTCTCACGCACGGATGGCGTATTGCCATCTTTATCGGGACCATTGCCATCTACA
CCTTCATCTATGTCCATCTCAAGCGCGTCTTTGGTCGTTTTCGCGTCAGCGGTCCTTCAACCGGAAACACCACGT
CCCGAGATCAGACCGTGATAGAACATGATTTCGACAACACCGATTCGCAACACATTCTCGTCTCCAGCTCCTTCG
CAGTCTCCCACGAACTAGACGACATGTCACACACGAGCAGCGAAACCATCAAGAACACCAGCTCAACCGGCAAGA
CAGCCGTCTGGGCCGTCGCCGCCTCCGAAGCCGGACCCTCCGATCCGGCAAAGTCGGCTTACAAGCGTCCCGGAG
CCGGAGGCGTCAGCAGACCAATGTCGAAGCTTCCCGCGCCGCCTAACCTCAAGAAGATGCTCCTGATGAACGGAT
ACCCGCTCGCCTACATCGTTCTCTGGCTGCCCGGCATGATCAACCGGCTTGCCGAGTCTACGGGCCATTCGCCGC
GGTGGTTGCGTGCGCTACAGAGCTCTACGCAGTTCATAGGCTTTGTCAACGCTTTTACTTACGGATTCAGCGAGC
ATCTTCGTCGTGTTCATCGGCATTGGTCCAAGAAGCGGGATGGGCGGCGAGACCGGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail