Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02991
Gene name
Locationscaffold_03:337334..337874
Strand-
Gene length (bp)540
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04828 GFA Glutathione-dependent formaldehyde-activating enzyme 3.5E-24 28 117

GO

GO Term Description Terminal node
GO:0016846 carbon-sulfur lyase activity Yes
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7588 0.3648 0.1724 0.0707 0.0334 0.002 0.0158 0.13 0.04 0.0078

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup446
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3428
Ophiocordyceps australis map64 (Brazil) OphauB2|7120
Ophiocordyceps camponoti-floridani Ophcf2|02991 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05475
Ophiocordyceps camponoti-rufipedis Ophun1|3452
Ophiocordyceps camponoti-rufipedis Ophun1|5332
Ophiocordyceps kimflemingae Ophio5|2435
Ophiocordyceps kimflemingae Ophio5|7341
Ophiocordyceps subramaniannii Hirsu2|7957

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02991
MPLTGHCLCKAVTYSVAVDEPLMTGYDHCDDCQRQSGSTYSLVSVVPRDKLTIEGNVKRWKGKGASGMAVYRVFC
PECGSPIAHEPDANKAISALKSGTLDTEIKKKLKPSVEIWTAGKLPFCQEKLEKAFEHMPQ*
Coding >Ophcf2|02991
ATGCCTCTCACCGGACACTGCCTCTGCAAGGCCGTCACCTACTCGGTCGCTGTCGATGAGCCTCTCATGACGGGC
TACGACCACTGCGACGACTGTCAACGCCAGAGCGGCTCGACATACTCCCTGGTTTCGGTCGTGCCGCGGGACAAG
TTGACCATCGAGGGCAACGTCAAGAGGTGGAAAGGAAAGGGCGCCTCCGGCATGGCCGTCTACCGCGTCTTCTGC
CCCGAGTGCGGTTCTCCAATTGCGCACGAGCCCGATGCCAATAAGGCCATCAGCGCGCTCAAGTCTGGGACGCTC
GACACCGAGATAAAGAAGAAGCTTAAGCCGAGTGTTGAGATTTGGACGGCTGGGAAGCTGCCGTTCTGTCAAGAG
AAGCTGGAGAAGGCGTTTGAGCACATGCCCCAGTAG
Transcript >Ophcf2|02991
ATGCCTCTCACCGGACACTGCCTCTGCAAGGCCGTCACCTACTCGGTCGCTGTCGATGAGCCTCTCATGACGGGC
TACGACCACTGCGACGACTGTCAACGCCAGAGCGGCTCGACATACTCCCTGGTTTCGGTCGTGCCGCGGGACAAG
TTGACCATCGAGGGCAACGTCAAGAGGTGGAAAGGAAAGGGCGCCTCCGGCATGGCCGTCTACCGCGTCTTCTGC
CCCGAGTGCGGTTCTCCAATTGCGCACGAGCCCGATGCCAATAAGGCCATCAGCGCGCTCAAGTCTGGGACGCTC
GACACCGAGATAAAGAAGAAGCTTAAGCCGAGTGTTGAGATTTGGACGGCTGGGAAGCTGCCGTTCTGTCAAGAG
AAGCTGGAGAAGGCGTTTGAGCACATGCCCCAGTAG
Gene >Ophcf2|02991
ATGCCTCTCACCGGACACTGCCTCTGCAAGGCCGTCACCTACTCGGTCGCTGTCGATGAGCCTCTCATGACGGGC
TACGACCACTGCGACGACTGTCAACGCCAGAGCGGCTCGACATACTGTGCGGTTCCCCATCTTGACATCCCCCTT
CAAAGCCTCAGTCAAAGCCTCAGTCCTAACGAGTCGTCTCCAGCCCTGGTTTCGGTCGTGCCGCGGGACAAGTTG
ACCATCGAGGGCAACGTCAAGAGGTGGAAAGGAAAGGGCGCCTCCGGCATGGCCGTCTACCGCGTCTTCTGCCCC
GAGTGCGGTTCTCCAATTGCGCACGAGCCCGATGCCAATAAGGCCATCAGCGCGCTCAAGTCTGGGACGCTCGAC
ACCGAGATAAAGAAGAAGCTTAAGCCGGTAAGTTGTGTCTCGTTGGGGTAGGCTGACTTGATGGCTCATGATGGT
TACGTGTAGAGTGTTGAGATTTGGACGGCTGGGAAGCTGCCGTTCTGTCAAGAGAAGCTGGAGAAGGCGTTTGAG
CACATGCCCCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail