Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02987
Gene name
Locationscaffold_03:326455..328033
Strand-
Gene length (bp)1578
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 3.2E-48 59 335

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.141 0.0981 0.9138 0.0619 0.1331 0.0367 0.3321 0.3611 0.1294 0.0145

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.99952

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH13_1 8.6E-99 58 338

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6716
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02987 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5328
Ophiocordyceps kimflemingae Ophio5|7346
Ophiocordyceps subramaniannii Hirsu2|6899

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02987
MKASSVLACILQLCVPALAADAAAWKSRSIYFALTDRFEQNTTDGDRGPCYELGRYCGGTFRGMESRLDYIKELG
FDAIWISPVVKNHWDGYHGYWAQDLYTINPNFGTADELKSLDMFVMVDVVANHMGEPLAENRPEPLNQEASYHWP
CTINYADQGSIEYCRIGGLPDLNTQDAQIRNLLYDWVRWLVNEFQLDGLRVDTLRHVEKDFWPGFTAAAGVFTIG
EVFTSSVDVLAGYRDGVSSLLNYAIYHPLRDFYLQRGSSQALIDTHDAISRAFPDPTVLGNFIDNHDNPRWLNQR
DDHALLKNALTYLLLARGIPILYYGTEQGYAGGQEPFNRESLWHTNFNNETDLYRFISRVSSLRKAEAGLAENDH
SHLMVEDTGYAWSRAGGDVIAVTSNIGSGDSRDYCIFTRRPAGLWTDAFDGQDYMADERGRMCVHVSHGNPIIMV
AAKTMLGGEHRDVSGKN*
Coding >Ophcf2|02987
ATGAAGGCTTCCTCTGTTCTCGCTTGCATCCTTCAGCTCTGCGTCCCTGCACTCGCTGCGGACGCGGCGGCTTGG
AAGTCACGCAGCATCTACTTTGCCCTGACGGATCGTTTCGAGCAAAACACCACCGATGGCGATAGAGGGCCTTGC
TATGAGCTGGGACGGTACTGCGGAGGCACCTTTCGGGGCATGGAGTCTAGGCTCGATTACATCAAGGAGTTGGGC
TTTGATGCTATCTGGATCTCGCCTGTTGTGAAGAATCATTGGGATGGCTATCACGGATACTGGGCTCAGGATCTG
TATACCATAAACCCCAACTTCGGAACAGCCGACGAGCTCAAAAGCCTCGACATGTTCGTCATGGTCGACGTCGTC
GCCAACCACATGGGCGAACCCCTGGCCGAAAACAGACCCGAGCCCCTGAACCAAGAAGCATCGTACCACTGGCCC
TGCACGATCAACTACGCAGATCAAGGAAGCATCGAATACTGTCGTATCGGCGGCCTCCCCGATCTCAACACTCAA
GATGCTCAGATCCGCAATCTCCTCTATGACTGGGTCCGCTGGCTCGTCAACGAGTTTCAGCTCGACGGCCTCCGC
GTAGATACGCTCAGACACGTCGAGAAGGACTTTTGGCCGGGCTTCACGGCTGCCGCTGGCGTCTTCACCATCGGA
GAGGTCTTTACTTCCAGCGTCGATGTCCTGGCAGGCTACCGCGACGGAGTATCGAGTCTGCTCAACTACGCCATC
TACCACCCTCTACGGGACTTTTACCTGCAGAGGGGATCATCGCAGGCGCTCATCGATACGCACGATGCCATCAGC
CGCGCGTTTCCTGATCCGACGGTGTTGGGCAACTTTATCGACAACCACGATAACCCGAGATGGCTCAACCAGAGA
GATGATCACGCTCTGCTCAAGAATGCCCTCACCTATCTTCTTCTCGCCCGCGGCATTCCCATCCTCTACTACGGA
ACCGAGCAGGGATACGCCGGCGGCCAGGAGCCCTTCAACCGCGAGAGCCTCTGGCACACAAACTTCAACAATGAG
ACGGACCTTTACCGCTTCATCAGCCGCGTCTCGTCCCTGCGGAAGGCCGAGGCGGGTCTTGCAGAGAACGACCAC
AGCCACCTCATGGTGGAAGATACGGGATACGCATGGAGCCGTGCGGGCGGAGACGTGATTGCGGTGACGAGCAAT
ATTGGGAGCGGAGACTCTCGGGACTATTGTATCTTTACGAGGAGGCCTGCTGGCTTGTGGACGGATGCGTTTGAC
GGGCAGGACTATATGGCTGATGAAAGGGGGCGGATGTGTGTTCACGTCTCGCACGGGAACCCGATCATCATGGTT
GCTGCGAAGACGATGCTCGGGGGGGAGCACCGGGATGTTTCGGGGAAGAATTAG
Transcript >Ophcf2|02987
ATGAAGGCTTCCTCTGTTCTCGCTTGCATCCTTCAGCTCTGCGTCCCTGCACTCGCTGCGGACGCGGCGGCTTGG
AAGTCACGCAGCATCTACTTTGCCCTGACGGATCGTTTCGAGCAAAACACCACCGATGGCGATAGAGGGCCTTGC
TATGAGCTGGGACGGTACTGCGGAGGCACCTTTCGGGGCATGGAGTCTAGGCTCGATTACATCAAGGAGTTGGGC
TTTGATGCTATCTGGATCTCGCCTGTTGTGAAGAATCATTGGGATGGCTATCACGGATACTGGGCTCAGGATCTG
TATACCATAAACCCCAACTTCGGAACAGCCGACGAGCTCAAAAGCCTCGACATGTTCGTCATGGTCGACGTCGTC
GCCAACCACATGGGCGAACCCCTGGCCGAAAACAGACCCGAGCCCCTGAACCAAGAAGCATCGTACCACTGGCCC
TGCACGATCAACTACGCAGATCAAGGAAGCATCGAATACTGTCGTATCGGCGGCCTCCCCGATCTCAACACTCAA
GATGCTCAGATCCGCAATCTCCTCTATGACTGGGTCCGCTGGCTCGTCAACGAGTTTCAGCTCGACGGCCTCCGC
GTAGATACGCTCAGACACGTCGAGAAGGACTTTTGGCCGGGCTTCACGGCTGCCGCTGGCGTCTTCACCATCGGA
GAGGTCTTTACTTCCAGCGTCGATGTCCTGGCAGGCTACCGCGACGGAGTATCGAGTCTGCTCAACTACGCCATC
TACCACCCTCTACGGGACTTTTACCTGCAGAGGGGATCATCGCAGGCGCTCATCGATACGCACGATGCCATCAGC
CGCGCGTTTCCTGATCCGACGGTGTTGGGCAACTTTATCGACAACCACGATAACCCGAGATGGCTCAACCAGAGA
GATGATCACGCTCTGCTCAAGAATGCCCTCACCTATCTTCTTCTCGCCCGCGGCATTCCCATCCTCTACTACGGA
ACCGAGCAGGGATACGCCGGCGGCCAGGAGCCCTTCAACCGCGAGAGCCTCTGGCACACAAACTTCAACAATGAG
ACGGACCTTTACCGCTTCATCAGCCGCGTCTCGTCCCTGCGGAAGGCCGAGGCGGGTCTTGCAGAGAACGACCAC
AGCCACCTCATGGTGGAAGATACGGGATACGCATGGAGCCGTGCGGGCGGAGACGTGATTGCGGTGACGAGCAAT
ATTGGGAGCGGAGACTCTCGGGACTATTGTATCTTTACGAGGAGGCCTGCTGGCTTGTGGACGGATGCGTTTGAC
GGGCAGGACTATATGGCTGATGAAAGGGGGCGGATGTGTGTTCACGTCTCGCACGGGAACCCGATCATCATGGTT
GCTGCGAAGACGATGCTCGGGGGGGAGCACCGGGATGTTTCGGGGAAGAATTAG
Gene >Ophcf2|02987
ATGAAGGCTTCCTCTGTTCTCGCTTGCATCCTTCAGCTCTGCGTCCCTGCACTCGCTGCGGACGCGGCGGCTTGG
AAGTCACGCAGCATCTACTTTGCCCTGACGGATCGTTTCGAGCAAAACACCACCGATGGCGATAGAGGGCCTTGC
TATGAGCTGGGACGGTACTGCGGAGGCACCTTTCGGGGCATGGAGTCTAGGCTCGATTACATCAAGGAGTTGGGC
TTTGATGCTATCTGGATCTCGCCTGTTGTGAAGAGTGGGTGACTTTTTTTTTTTTTTTTGCCTGGCATGGGCTTA
TCTATACCGTCTCGATCAGGGTGAGATGCTGACCCTGTATCGTGAGCTTCTTCTAGATCATTGGGATGGCTATCA
CGGATACTGGGCTCAGGATCTGTATACCATAAACCCCAACTTCGGAACAGCCGACGAGCTCAAAAGCCTCGTCAA
CGCCGCACACAGCAAGGCAAGGCCCGACAAAACCCCCTCCCTGAGAGCAGAACCCTTGCTAACCTGGGATAGGAC
ATGTTCGTCATGGTCGACGTCGTCGCCAACCACATGGGCGAACCCCTGGCCGAAAACAGACCCGAGCCCCTGAAC
CAAGAAGCATCGTACCACTGGCCCTGCACGATCAACTACGCAGATCAAGGAAGCATCGAATACTGTCGTATCGGC
GGCCTCCCCGATCTCAACACTCAAGATGCTCAGATCCGCAATCTCCTCTATGACTGGGTCCGCTGGCTCGTCAAC
GAGTTTCAGCTCGACGGCCTCCGCGTAGATACGCTCAGACACGTCGAGAAGGACTTTTGGCCGGGCTTCACGGCT
GCCGCTGGCGTCTTCACCATCGGAGAGGTCTTTACTTCCAGCGTCGATGTCCTGGCAGGCTACCGCGACGGAGTA
TCGAGTCTGCTCAACTACGCCATCTACCACCCTCTACGGGACTTTTACCTGCAGAGGGGATCATCGCAGGCGCTC
ATCGATACGCACGATGCCATCAGCCGCGCGTTTCCTGATCCGACGGTGTTGGGCAACTTTATCGACAACCACGAT
AACCCGAGATGGCTCAACCAGAGAGATGATCACGCTCTGCTCAAGAATGCCCTCACCTATCTTCTTCTCGCCCGC
GGCATTCCCATCCTCTACTACGGAACCGAGCAGGGATACGCCGGCGGCCAGGAGCCCTTCAACCGCGAGAGCCTC
TGGCACACAAACTTCAACAATGAGACGGACCTTTACCGCTTCATCAGCCGCGTCTCGTCCCTGCGGAAGGCCGAG
GCGGGTCTTGCAGAGAACGACCACAGCCACCTCATGGTGGAAGATACGGGATACGCATGGAGCCGTGCGGGCGGA
GACGTGATTGCGGTGACGAGCAATATTGGGAGCGGAGACTCTCGGGACTATTGTATCTTTACGAGGAGGCCTGCT
GGCTTGTGGACGGATGCGTTTGACGGGCAGGACTATATGGCTGATGAAAGGGGGCGGATGTGTGTTCACGTCTCG
CACGGGAACCCGATCATCATGGTTGCTGCGAAGACGATGCTCGGGGGGGAGCACCGGGATGTTTCGGGGAAGAAT
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail