Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02986
Gene name
Locationscaffold_03:324297..326184
Strand+
Gene length (bp)1887
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 5.2E-26 173 295
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 7.6E-14 447 599
PF08022 FAD_binding_8 FAD-binding domain 5.3E-08 357 437
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 5.2E-06 452 516

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 123 145 22
3 165 187 22
4 207 229 22
5 250 272 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 500.94 214.60 787.28
Alive In ants, during behavior modification 1.33 0.09 2.57
Dead In ants, recently dead 1.08 0.12 2.04

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.588716 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02986
MYRQPLRRHIQDLSDGSAREPHWGYADRVVPCKKDAGTCAYLDLVYAAHDRSMLYVGIFWATICAVLAVWIVARF
VSRPVGLEGCSRSAGRMTRLSASLASARRRLLLPVSGPPWLFGRGSRAQLLVLATLTGYIMVWSFVGIAYRSWLT
PVKGNPAIFSTRTSLGPWSNRIGVVAFGLTPLSVLLSCRESLLSVLTGLPYQTFGFLHRWLGYIIFAQSSLHTIS
WCVIQLRLYQPQPKTGLEWIKEKYIIWGLVAMILLLLLFLLSTPWAIRRAGYEFFRKTHYVLAMVYIGACWGHWE
RLQCFLIPSFIFWGLDRAARLVRTALLHYHPWAKSGLFSSFETAEATIKMFKDDTGGQVVRLDLENDQDTWKVGQ
HFFLCFPRCSFWQSHPFTPLNLPVLRNGSVRHSYIIRSMGGETRKLTARHPSTSVLLTGPYGEDVASRVASRNVI
CVAGGTGIAYVMPLLLRLAQQQPIPDRRIELVWAVRHLSHVEWVREEMDSLQRSQKTLNLTVRVFATRDGETPLR
DKAEAVSADPSPSDEPVNNNDGMSIHKTGDGVTESSRHPDLHRLVTDFVESTVSGPTAIVASGPGGVLTDLRAVA
AGINSPSKVWKGKTRFDVDLILDDRMEW*
Coding >Ophcf2|02986
ATGTATCGGCAACCTCTCCGTCGGCATATCCAGGACCTTTCGGATGGCAGCGCCCGTGAGCCGCACTGGGGATAC
GCAGATCGTGTCGTGCCCTGCAAGAAAGATGCCGGAACATGCGCCTACCTCGACCTCGTCTACGCCGCTCACGAT
AGGAGCATGCTCTACGTGGGCATCTTCTGGGCCACAATCTGCGCGGTTTTAGCCGTCTGGATCGTTGCTCGCTTC
GTCTCTCGTCCAGTTGGACTCGAGGGCTGCTCTAGATCAGCGGGTAGGATGACGAGGCTTTCTGCCTCGCTTGCA
TCTGCTCGTCGAAGACTCCTTTTACCCGTTTCCGGACCACCATGGCTCTTTGGTCGCGGTTCACGAGCACAGCTT
CTCGTCCTGGCAACACTGACGGGCTACATCATGGTCTGGAGCTTCGTCGGCATCGCCTACAGAAGCTGGCTTACA
CCCGTCAAGGGTAATCCGGCCATCTTCAGCACGCGCACCAGCCTCGGACCCTGGTCTAACCGGATAGGCGTCGTC
GCCTTTGGCCTGACACCGCTTTCGGTCCTATTATCCTGCCGAGAGTCGTTGCTGTCCGTCCTCACCGGCCTTCCG
TATCAGACCTTTGGCTTCCTTCACCGCTGGCTAGGATACATCATCTTCGCTCAGAGTTCTCTTCATACCATTTCC
TGGTGTGTCATCCAGCTTCGTCTCTACCAGCCTCAACCGAAGACGGGACTCGAATGGATCAAGGAGAAGTACATC
ATCTGGGGTCTGGTCGCCATGATCCTGCTCCTGCTGCTCTTCCTTCTGAGCACCCCCTGGGCCATCCGACGGGCA
GGCTACGAGTTCTTCCGCAAAACCCACTACGTGCTGGCCATGGTTTACATCGGGGCTTGCTGGGGCCACTGGGAG
AGGCTACAATGCTTCCTCATCCCGTCCTTCATCTTCTGGGGGTTGGACCGGGCCGCCCGTCTCGTCCGCACAGCG
TTGCTTCACTACCATCCCTGGGCTAAATCCGGTCTCTTCAGCAGCTTCGAGACGGCCGAGGCCACTATCAAGATG
TTCAAAGATGATACGGGAGGCCAGGTCGTGCGCCTGGACCTGGAAAACGACCAAGACACGTGGAAAGTCGGACAG
CATTTCTTCCTCTGCTTTCCGCGCTGTAGCTTCTGGCAATCTCACCCCTTTACGCCCCTCAACTTACCCGTCCTC
CGCAACGGAAGCGTCAGACACTCATACATCATCAGATCGATGGGCGGCGAGACGCGGAAGCTGACCGCCCGTCAT
CCATCGACTTCAGTCCTCCTCACCGGGCCATACGGAGAAGACGTGGCTAGCAGAGTGGCATCACGCAACGTCATC
TGCGTCGCGGGCGGCACCGGCATCGCGTACGTCATGCCGCTGCTCCTCCGGCTGGCACAACAGCAGCCAATTCCC
GATCGTAGGATAGAGCTGGTCTGGGCCGTGAGACACTTGAGTCACGTCGAGTGGGTGAGGGAAGAGATGGACTCT
CTACAGCGGTCTCAGAAGACGCTCAACCTGACCGTCCGCGTCTTCGCTACTAGAGATGGCGAGACGCCTCTCAGA
GACAAGGCGGAGGCCGTATCAGCGGATCCAAGCCCGTCCGATGAGCCCGTCAACAACAACGACGGCATGTCCATC
CACAAGACCGGAGATGGCGTGACGGAAAGCAGCAGACATCCTGACCTGCATCGCCTCGTCACCGACTTTGTCGAG
TCGACGGTCTCCGGGCCGACGGCCATCGTGGCCAGCGGTCCTGGCGGTGTGCTTACGGACTTGAGGGCTGTTGCC
GCTGGTATCAATTCGCCGTCGAAGGTGTGGAAGGGGAAGACGAGGTTCGATGTTGATCTGATCCTCGACGACAGG
ATGGAATGGTGA
Transcript >Ophcf2|02986
ATGTATCGGCAACCTCTCCGTCGGCATATCCAGGACCTTTCGGATGGCAGCGCCCGTGAGCCGCACTGGGGATAC
GCAGATCGTGTCGTGCCCTGCAAGAAAGATGCCGGAACATGCGCCTACCTCGACCTCGTCTACGCCGCTCACGAT
AGGAGCATGCTCTACGTGGGCATCTTCTGGGCCACAATCTGCGCGGTTTTAGCCGTCTGGATCGTTGCTCGCTTC
GTCTCTCGTCCAGTTGGACTCGAGGGCTGCTCTAGATCAGCGGGTAGGATGACGAGGCTTTCTGCCTCGCTTGCA
TCTGCTCGTCGAAGACTCCTTTTACCCGTTTCCGGACCACCATGGCTCTTTGGTCGCGGTTCACGAGCACAGCTT
CTCGTCCTGGCAACACTGACGGGCTACATCATGGTCTGGAGCTTCGTCGGCATCGCCTACAGAAGCTGGCTTACA
CCCGTCAAGGGTAATCCGGCCATCTTCAGCACGCGCACCAGCCTCGGACCCTGGTCTAACCGGATAGGCGTCGTC
GCCTTTGGCCTGACACCGCTTTCGGTCCTATTATCCTGCCGAGAGTCGTTGCTGTCCGTCCTCACCGGCCTTCCG
TATCAGACCTTTGGCTTCCTTCACCGCTGGCTAGGATACATCATCTTCGCTCAGAGTTCTCTTCATACCATTTCC
TGGTGTGTCATCCAGCTTCGTCTCTACCAGCCTCAACCGAAGACGGGACTCGAATGGATCAAGGAGAAGTACATC
ATCTGGGGTCTGGTCGCCATGATCCTGCTCCTGCTGCTCTTCCTTCTGAGCACCCCCTGGGCCATCCGACGGGCA
GGCTACGAGTTCTTCCGCAAAACCCACTACGTGCTGGCCATGGTTTACATCGGGGCTTGCTGGGGCCACTGGGAG
AGGCTACAATGCTTCCTCATCCCGTCCTTCATCTTCTGGGGGTTGGACCGGGCCGCCCGTCTCGTCCGCACAGCG
TTGCTTCACTACCATCCCTGGGCTAAATCCGGTCTCTTCAGCAGCTTCGAGACGGCCGAGGCCACTATCAAGATG
TTCAAAGATGATACGGGAGGCCAGGTCGTGCGCCTGGACCTGGAAAACGACCAAGACACGTGGAAAGTCGGACAG
CATTTCTTCCTCTGCTTTCCGCGCTGTAGCTTCTGGCAATCTCACCCCTTTACGCCCCTCAACTTACCCGTCCTC
CGCAACGGAAGCGTCAGACACTCATACATCATCAGATCGATGGGCGGCGAGACGCGGAAGCTGACCGCCCGTCAT
CCATCGACTTCAGTCCTCCTCACCGGGCCATACGGAGAAGACGTGGCTAGCAGAGTGGCATCACGCAACGTCATC
TGCGTCGCGGGCGGCACCGGCATCGCGTACGTCATGCCGCTGCTCCTCCGGCTGGCACAACAGCAGCCAATTCCC
GATCGTAGGATAGAGCTGGTCTGGGCCGTGAGACACTTGAGTCACGTCGAGTGGGTGAGGGAAGAGATGGACTCT
CTACAGCGGTCTCAGAAGACGCTCAACCTGACCGTCCGCGTCTTCGCTACTAGAGATGGCGAGACGCCTCTCAGA
GACAAGGCGGAGGCCGTATCAGCGGATCCAAGCCCGTCCGATGAGCCCGTCAACAACAACGACGGCATGTCCATC
CACAAGACCGGAGATGGCGTGACGGAAAGCAGCAGACATCCTGACCTGCATCGCCTCGTCACCGACTTTGTCGAG
TCGACGGTCTCCGGGCCGACGGCCATCGTGGCCAGCGGTCCTGGCGGTGTGCTTACGGACTTGAGGGCTGTTGCC
GCTGGTATCAATTCGCCGTCGAAGGTGTGGAAGGGGAAGACGAGGTTCGATGTTGATCTGATCCTCGACGACAGG
ATGGAATGGTGA
Gene >Ophcf2|02986
ATGTATCGGCAACCTCTCCGTCGGCATATCCAGGACCTTTCGGATGGCAGCGCCCGTGAGCCGCACTGGGGATAC
GCAGATCGTGTCGTGCCCTGCAAGAAAGATGCCGGAACATGCGCCTACCTCGACCTCGTCTACGCCGCTCACGAT
AGGAGCATGCTCTACGTGGGCATCTTCTGGGCCACAATCTGCGCGGTTTTAGCCGTCTGGATCGTTGCTCGCTTC
GTCTCTCGTCCAGTTGGACTCGAGGGCTGCTCTAGATCAGCGGGTAGGATGACGAGGCTTTCTGCCTCGCTTGCA
TCTGCTCGTCGAAGACTCCTTTTACCCGTTTCCGGACCACCATGGCTCTTTGGTCGCGGTTCACGAGCACAGCTT
CTCGTCCTGGCAACACTGACGGGCTACATCATGGTCTGGAGCTTCGTCGGCATCGCCTACAGAAGCTGGCTTACA
CCCGTCAAGGGTAATCCGGCCATCTTCAGCACGCGCACCAGCCTCGGACCCTGGTCTAACCGGATAGGCGTCGTC
GCCTTTGGCCTGACACCGCTTTCGGTCCTATTATCCTGCCGAGAGTCGTTGCTGTCCGTCCTCACCGGCCTTCCG
TATCAGACCTTTGGCTTCCTTCACCGCTGGCTAGGATACATCATCTTCGCTCAGAGTTCTCTTCATACCATTTCC
TGGTGTGTCATCCAGCTTCGTCTCTACCAGCCTCAACCGAAGACGGGACTCGAATGGATCAAGGAGAAGTACATC
ATCTGGGGTCTGGTCGCCATGATCCTGCTCCTGCTGCTCTTCCTTCTGAGCACCCCCTGGGCCATCCGACGGGCA
GGCTACGAGTTCTTCCGCAAAACCCACTACGTGCTGGCCATGGTTTACATCGGGGCTTGCTGGGGCCACTGGGAG
AGGCTACAATGCTTCCTCATCCCGTCCTTCATCTTCTGGGGGTTGGACCGGGCCGCCCGTCTCGTCCGCACAGCG
TTGCTTCACTACCATCCCTGGGCTAAATCCGGTCTCTTCAGCAGCTTCGAGACGGCCGAGGCCACTATCAAGATG
TTCAAAGATGATACGGGAGGCCAGGTCGTGCGCCTGGACCTGGAAAACGACCAAGACACGTGGAAAGTCGGACAG
CATTTCTTCCTCTGCTTTCCGCGCTGTAGCTTCTGGCAATCTCACCCCTTTACGCCCCTCAACTTACCCGTCCTC
CGCAACGGAAGCGTCAGACACTCATACATCATCAGATCGATGGGCGGCGAGACGCGGAAGCTGACCGCCCGTCAT
CCATCGACTTCAGTCCTCCTCACCGGGCCATACGGAGAAGACGTGGCTAGCAGAGTGGCATCACGCAACGTCATC
TGCGTCGCGGGCGGCACCGGCATCGCGTACGTCATGCCGCTGCTCCTCCGGCTGGCACAACAGCAGCCAATTCCC
GATCGTAGGATAGAGCTGGTCTGGGCCGTGAGACACTTGAGTCACGTCGAGTGGGTGAGGGAAGAGATGGACTCT
CTACAGCGGTCTCAGAAGACGCTCAACCTGACCGTCCGCGTCTTCGCTACTAGAGATGGCGAGACGCCTCTCAGA
GACAAGGCGGAGGCCGTATCAGCGGATCCAAGCCCGTCCGATGAGCCCGTCAACAACAACGACGGCATGTCCATC
CACAAGACCGGAGATGGCGTGACGGAAAGCAGCAGACATCCTGACCTGCATCGCCTCGTCACCGACTTTGTCGAG
TCGACGGTCTCCGGGCCGACGGCCATCGTGGCCAGCGGTCCTGGCGGTGTGCTTACGGACTTGAGGGCTGTTGCC
GCTGGTATCAATTCGCCGTCGAAGGTGTGGAAGGGGAAGACGAGGTTCGATGTTGATCTGATCCTCGACGACAGG
ATGGAATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail