Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02982
Gene name
Locationscaffold_03:310449..312936
Strand-
Gene length (bp)2487
Transcript length (bp)2487
Coding sequence length (bp)2487
Protein length (aa) 829

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 7.6E-45 297 485
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.0E-25 504 718
PF00403 HMA Heavy-metal-associated domain 1.8E-07 17 66

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 196 218 22
3 231 253 22
4 263 282 19
5 413 435 22
6 455 477 22
7 768 790 22
8 805 827 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02982
MRTDVEKAQGIEHMNLSVDGMTCSGCGIKMERVLKGLAGVSAVRVNFVMASAEFSLDTSVCSPEAIVCAAERESG
FRCLRLSADDQTLDLLSTGSSAKALITAAATMDGVREAIIISRKVVRVTYDPAIIGARILMRQMGSYSTGLAPPV
DDPSLSVGRTRLRNGLIKTTISACCTLPVAVMAFSAKGLVEERTKMLTSVTLATTVQLIAVPVFYMPAMRTLVHR
RSLDMNMLVATSITAAYVYSVVAMAFFLAGRALEVGPIFETSTLLVTLVLLGRLVAAYGRLRAVAAVSFRSLQAS
RAVIVENGKEREMDARLLQYGDELKIEAHAPIPTDAVVLAGRSEVDESIITGESLPVFKGPGDGIVAGSINGTGT
LNARLRRLPGRNTVTDIARLVEEAANSRPRIQDMADRVASCFMPVVSGIAMIVIVAWTVVGIRIRGYGTGRAVAN
AMTYAVATLAVSCPCALGIAVPLVLVVAGGVAARNGVIIKSGECTERARKVTDVVLDKTGTMTEAALDVTDEKLF
TAEDDEAIAISRALVADSKHPVSLAVARHLQDRRQHPIKLKDRLDLPGSGLRALVGDSAVVVRAGSAAWTGTERH
PAVTELLHRGLTLLVVTRDGELLAVFGMRTKLRPETAAVVGHLRRRGIVVHVVSGDHKAAVDAAAAEVGIDGHDV
TLVASKCSPADKRQYVARLMAKGRCVMFVGDGTNDAVAVTQADVGVQLTSFDSSSSASSGSHVTRAAADVVLLNG
LDGIRVLLRISAVSFRRIIFNFVWSAAYNVLAVLLASGALVAVRIPPGLAGLGEFVSVLPVILAAASMLWKGIPA
YGS*
Coding >Ophcf2|02982
ATGCGGACCGATGTGGAAAAGGCTCAGGGGATCGAGCACATGAATCTCTCGGTCGACGGGATGACGTGCTCCGGC
TGCGGTATCAAGATGGAGCGCGTTCTCAAGGGTCTGGCAGGCGTATCAGCAGTACGCGTCAACTTCGTCATGGCC
TCGGCCGAGTTCAGTCTCGACACGTCCGTCTGTTCTCCCGAAGCCATCGTCTGCGCCGCCGAAAGAGAGTCCGGC
TTCCGATGCCTACGTCTCTCGGCCGATGACCAGACACTAGACCTGCTATCAACAGGCTCGTCGGCCAAGGCTCTC
ATCACCGCGGCAGCCACCATGGACGGCGTCAGAGAGGCCATCATCATCAGCAGAAAGGTGGTGCGGGTCACGTAC
GATCCGGCAATCATCGGGGCCCGGATCTTGATGCGACAGATGGGCTCCTACAGCACCGGTCTGGCACCGCCCGTC
GACGACCCGAGCCTCTCCGTCGGCCGGACACGGCTCCGGAACGGACTCATCAAGACGACCATCTCGGCCTGTTGC
ACGCTTCCCGTCGCCGTCATGGCCTTTTCTGCCAAAGGTCTTGTCGAGGAGCGTACCAAGATGCTGACGTCGGTA
ACGCTGGCTACCACGGTTCAGCTCATCGCCGTACCCGTCTTTTACATGCCGGCCATGAGGACCCTAGTCCATAGG
CGTTCTCTCGACATGAACATGCTGGTCGCTACGAGCATCACGGCCGCCTACGTCTACTCCGTCGTCGCCATGGCC
TTCTTCCTGGCTGGTCGTGCGCTCGAGGTGGGACCCATCTTCGAGACGAGCACCTTGCTGGTGACGCTCGTGCTT
CTCGGAAGGCTGGTGGCGGCCTACGGGAGACTACGGGCCGTGGCGGCCGTATCGTTTCGATCCTTACAAGCGTCG
AGAGCCGTCATCGTCGAGAACGGAAAGGAGAGGGAGATGGACGCTCGGCTGTTGCAGTACGGAGATGAGCTCAAG
ATAGAAGCCCACGCTCCGATACCGACGGATGCCGTTGTCCTCGCCGGTCGAAGCGAGGTGGACGAGTCCATCATC
ACGGGCGAGAGTCTTCCCGTATTCAAAGGGCCGGGAGACGGCATCGTGGCCGGCTCTATCAACGGGACCGGAACC
CTAAACGCCAGGTTGCGACGCCTCCCGGGCCGAAACACGGTGACGGACATTGCCCGGTTGGTCGAGGAGGCGGCC
AACTCGCGGCCTCGCATTCAGGACATGGCCGACCGCGTGGCCAGCTGCTTCATGCCGGTGGTATCGGGCATCGCC
ATGATTGTCATCGTCGCCTGGACCGTCGTCGGCATCCGGATCCGTGGTTACGGGACGGGCAGGGCCGTGGCCAAC
GCCATGACATATGCCGTCGCTACACTGGCCGTCTCGTGCCCCTGTGCTCTCGGGATAGCGGTCCCCCTGGTTCTC
GTCGTGGCCGGGGGCGTCGCCGCCCGTAACGGCGTCATCATCAAGTCCGGCGAATGCACGGAGCGCGCCCGCAAG
GTGACGGATGTGGTTCTCGACAAGACGGGGACCATGACGGAGGCCGCCCTCGACGTCACCGACGAGAAGCTATTC
ACTGCAGAAGACGACGAGGCCATCGCCATCTCCAGGGCCCTCGTCGCCGACTCGAAGCATCCCGTCTCGCTGGCC
GTTGCCCGCCACCTGCAAGACCGCCGGCAGCACCCCATCAAGCTGAAGGATAGGCTCGACCTCCCCGGTTCCGGA
CTGAGGGCCCTCGTCGGGGACTCGGCCGTCGTCGTACGTGCCGGAAGCGCCGCCTGGACGGGAACGGAGCGTCAC
CCCGCCGTCACGGAACTCCTACACCGCGGCCTGACGCTCCTGGTGGTGACGCGTGATGGCGAGCTCCTGGCCGTC
TTCGGCATGCGCACCAAGCTCCGGCCCGAGACGGCTGCCGTTGTCGGACACCTCCGGAGACGCGGCATCGTCGTC
CACGTCGTTTCGGGAGATCACAAGGCGGCCGTCGACGCGGCGGCTGCAGAAGTCGGTATCGACGGTCATGATGTC
ACCCTCGTGGCTTCTAAATGCTCGCCCGCCGATAAGCGACAGTATGTGGCTCGTCTGATGGCAAAGGGTCGGTGC
GTAATGTTCGTCGGAGACGGAACAAACGACGCCGTGGCCGTGACTCAGGCAGACGTCGGCGTCCAGCTGACCAGC
TTCGATTCATCGTCATCGGCTTCATCTGGCAGTCACGTCACGAGGGCGGCCGCCGATGTCGTTCTTCTCAACGGC
TTGGACGGGATCCGCGTCTTGCTTCGTATCAGCGCCGTCAGCTTCCGCCGCATCATCTTCAACTTCGTCTGGTCG
GCTGCCTACAACGTGTTGGCCGTGCTGCTGGCGTCAGGGGCGCTGGTCGCCGTTCGCATCCCGCCGGGCCTCGCC
GGCCTGGGAGAGTTCGTCAGTGTCTTGCCTGTCATTTTAGCGGCTGCTTCTATGCTTTGGAAGGGGATTCCGGCT
TATGGGAGTTGA
Transcript >Ophcf2|02982
ATGCGGACCGATGTGGAAAAGGCTCAGGGGATCGAGCACATGAATCTCTCGGTCGACGGGATGACGTGCTCCGGC
TGCGGTATCAAGATGGAGCGCGTTCTCAAGGGTCTGGCAGGCGTATCAGCAGTACGCGTCAACTTCGTCATGGCC
TCGGCCGAGTTCAGTCTCGACACGTCCGTCTGTTCTCCCGAAGCCATCGTCTGCGCCGCCGAAAGAGAGTCCGGC
TTCCGATGCCTACGTCTCTCGGCCGATGACCAGACACTAGACCTGCTATCAACAGGCTCGTCGGCCAAGGCTCTC
ATCACCGCGGCAGCCACCATGGACGGCGTCAGAGAGGCCATCATCATCAGCAGAAAGGTGGTGCGGGTCACGTAC
GATCCGGCAATCATCGGGGCCCGGATCTTGATGCGACAGATGGGCTCCTACAGCACCGGTCTGGCACCGCCCGTC
GACGACCCGAGCCTCTCCGTCGGCCGGACACGGCTCCGGAACGGACTCATCAAGACGACCATCTCGGCCTGTTGC
ACGCTTCCCGTCGCCGTCATGGCCTTTTCTGCCAAAGGTCTTGTCGAGGAGCGTACCAAGATGCTGACGTCGGTA
ACGCTGGCTACCACGGTTCAGCTCATCGCCGTACCCGTCTTTTACATGCCGGCCATGAGGACCCTAGTCCATAGG
CGTTCTCTCGACATGAACATGCTGGTCGCTACGAGCATCACGGCCGCCTACGTCTACTCCGTCGTCGCCATGGCC
TTCTTCCTGGCTGGTCGTGCGCTCGAGGTGGGACCCATCTTCGAGACGAGCACCTTGCTGGTGACGCTCGTGCTT
CTCGGAAGGCTGGTGGCGGCCTACGGGAGACTACGGGCCGTGGCGGCCGTATCGTTTCGATCCTTACAAGCGTCG
AGAGCCGTCATCGTCGAGAACGGAAAGGAGAGGGAGATGGACGCTCGGCTGTTGCAGTACGGAGATGAGCTCAAG
ATAGAAGCCCACGCTCCGATACCGACGGATGCCGTTGTCCTCGCCGGTCGAAGCGAGGTGGACGAGTCCATCATC
ACGGGCGAGAGTCTTCCCGTATTCAAAGGGCCGGGAGACGGCATCGTGGCCGGCTCTATCAACGGGACCGGAACC
CTAAACGCCAGGTTGCGACGCCTCCCGGGCCGAAACACGGTGACGGACATTGCCCGGTTGGTCGAGGAGGCGGCC
AACTCGCGGCCTCGCATTCAGGACATGGCCGACCGCGTGGCCAGCTGCTTCATGCCGGTGGTATCGGGCATCGCC
ATGATTGTCATCGTCGCCTGGACCGTCGTCGGCATCCGGATCCGTGGTTACGGGACGGGCAGGGCCGTGGCCAAC
GCCATGACATATGCCGTCGCTACACTGGCCGTCTCGTGCCCCTGTGCTCTCGGGATAGCGGTCCCCCTGGTTCTC
GTCGTGGCCGGGGGCGTCGCCGCCCGTAACGGCGTCATCATCAAGTCCGGCGAATGCACGGAGCGCGCCCGCAAG
GTGACGGATGTGGTTCTCGACAAGACGGGGACCATGACGGAGGCCGCCCTCGACGTCACCGACGAGAAGCTATTC
ACTGCAGAAGACGACGAGGCCATCGCCATCTCCAGGGCCCTCGTCGCCGACTCGAAGCATCCCGTCTCGCTGGCC
GTTGCCCGCCACCTGCAAGACCGCCGGCAGCACCCCATCAAGCTGAAGGATAGGCTCGACCTCCCCGGTTCCGGA
CTGAGGGCCCTCGTCGGGGACTCGGCCGTCGTCGTACGTGCCGGAAGCGCCGCCTGGACGGGAACGGAGCGTCAC
CCCGCCGTCACGGAACTCCTACACCGCGGCCTGACGCTCCTGGTGGTGACGCGTGATGGCGAGCTCCTGGCCGTC
TTCGGCATGCGCACCAAGCTCCGGCCCGAGACGGCTGCCGTTGTCGGACACCTCCGGAGACGCGGCATCGTCGTC
CACGTCGTTTCGGGAGATCACAAGGCGGCCGTCGACGCGGCGGCTGCAGAAGTCGGTATCGACGGTCATGATGTC
ACCCTCGTGGCTTCTAAATGCTCGCCCGCCGATAAGCGACAGTATGTGGCTCGTCTGATGGCAAAGGGTCGGTGC
GTAATGTTCGTCGGAGACGGAACAAACGACGCCGTGGCCGTGACTCAGGCAGACGTCGGCGTCCAGCTGACCAGC
TTCGATTCATCGTCATCGGCTTCATCTGGCAGTCACGTCACGAGGGCGGCCGCCGATGTCGTTCTTCTCAACGGC
TTGGACGGGATCCGCGTCTTGCTTCGTATCAGCGCCGTCAGCTTCCGCCGCATCATCTTCAACTTCGTCTGGTCG
GCTGCCTACAACGTGTTGGCCGTGCTGCTGGCGTCAGGGGCGCTGGTCGCCGTTCGCATCCCGCCGGGCCTCGCC
GGCCTGGGAGAGTTCGTCAGTGTCTTGCCTGTCATTTTAGCGGCTGCTTCTATGCTTTGGAAGGGGATTCCGGCT
TATGGGAGTTGA
Gene >Ophcf2|02982
ATGCGGACCGATGTGGAAAAGGCTCAGGGGATCGAGCACATGAATCTCTCGGTCGACGGGATGACGTGCTCCGGC
TGCGGTATCAAGATGGAGCGCGTTCTCAAGGGTCTGGCAGGCGTATCAGCAGTACGCGTCAACTTCGTCATGGCC
TCGGCCGAGTTCAGTCTCGACACGTCCGTCTGTTCTCCCGAAGCCATCGTCTGCGCCGCCGAAAGAGAGTCCGGC
TTCCGATGCCTACGTCTCTCGGCCGATGACCAGACACTAGACCTGCTATCAACAGGCTCGTCGGCCAAGGCTCTC
ATCACCGCGGCAGCCACCATGGACGGCGTCAGAGAGGCCATCATCATCAGCAGAAAGGTGGTGCGGGTCACGTAC
GATCCGGCAATCATCGGGGCCCGGATCTTGATGCGACAGATGGGCTCCTACAGCACCGGTCTGGCACCGCCCGTC
GACGACCCGAGCCTCTCCGTCGGCCGGACACGGCTCCGGAACGGACTCATCAAGACGACCATCTCGGCCTGTTGC
ACGCTTCCCGTCGCCGTCATGGCCTTTTCTGCCAAAGGTCTTGTCGAGGAGCGTACCAAGATGCTGACGTCGGTA
ACGCTGGCTACCACGGTTCAGCTCATCGCCGTACCCGTCTTTTACATGCCGGCCATGAGGACCCTAGTCCATAGG
CGTTCTCTCGACATGAACATGCTGGTCGCTACGAGCATCACGGCCGCCTACGTCTACTCCGTCGTCGCCATGGCC
TTCTTCCTGGCTGGTCGTGCGCTCGAGGTGGGACCCATCTTCGAGACGAGCACCTTGCTGGTGACGCTCGTGCTT
CTCGGAAGGCTGGTGGCGGCCTACGGGAGACTACGGGCCGTGGCGGCCGTATCGTTTCGATCCTTACAAGCGTCG
AGAGCCGTCATCGTCGAGAACGGAAAGGAGAGGGAGATGGACGCTCGGCTGTTGCAGTACGGAGATGAGCTCAAG
ATAGAAGCCCACGCTCCGATACCGACGGATGCCGTTGTCCTCGCCGGTCGAAGCGAGGTGGACGAGTCCATCATC
ACGGGCGAGAGTCTTCCCGTATTCAAAGGGCCGGGAGACGGCATCGTGGCCGGCTCTATCAACGGGACCGGAACC
CTAAACGCCAGGTTGCGACGCCTCCCGGGCCGAAACACGGTGACGGACATTGCCCGGTTGGTCGAGGAGGCGGCC
AACTCGCGGCCTCGCATTCAGGACATGGCCGACCGCGTGGCCAGCTGCTTCATGCCGGTGGTATCGGGCATCGCC
ATGATTGTCATCGTCGCCTGGACCGTCGTCGGCATCCGGATCCGTGGTTACGGGACGGGCAGGGCCGTGGCCAAC
GCCATGACATATGCCGTCGCTACACTGGCCGTCTCGTGCCCCTGTGCTCTCGGGATAGCGGTCCCCCTGGTTCTC
GTCGTGGCCGGGGGCGTCGCCGCCCGTAACGGCGTCATCATCAAGTCCGGCGAATGCACGGAGCGCGCCCGCAAG
GTGACGGATGTGGTTCTCGACAAGACGGGGACCATGACGGAGGCCGCCCTCGACGTCACCGACGAGAAGCTATTC
ACTGCAGAAGACGACGAGGCCATCGCCATCTCCAGGGCCCTCGTCGCCGACTCGAAGCATCCCGTCTCGCTGGCC
GTTGCCCGCCACCTGCAAGACCGCCGGCAGCACCCCATCAAGCTGAAGGATAGGCTCGACCTCCCCGGTTCCGGA
CTGAGGGCCCTCGTCGGGGACTCGGCCGTCGTCGTACGTGCCGGAAGCGCCGCCTGGACGGGAACGGAGCGTCAC
CCCGCCGTCACGGAACTCCTACACCGCGGCCTGACGCTCCTGGTGGTGACGCGTGATGGCGAGCTCCTGGCCGTC
TTCGGCATGCGCACCAAGCTCCGGCCCGAGACGGCTGCCGTTGTCGGACACCTCCGGAGACGCGGCATCGTCGTC
CACGTCGTTTCGGGAGATCACAAGGCGGCCGTCGACGCGGCGGCTGCAGAAGTCGGTATCGACGGTCATGATGTC
ACCCTCGTGGCTTCTAAATGCTCGCCCGCCGATAAGCGACAGTATGTGGCTCGTCTGATGGCAAAGGGTCGGTGC
GTAATGTTCGTCGGAGACGGAACAAACGACGCCGTGGCCGTGACTCAGGCAGACGTCGGCGTCCAGCTGACCAGC
TTCGATTCATCGTCATCGGCTTCATCTGGCAGTCACGTCACGAGGGCGGCCGCCGATGTCGTTCTTCTCAACGGC
TTGGACGGGATCCGCGTCTTGCTTCGTATCAGCGCCGTCAGCTTCCGCCGCATCATCTTCAACTTCGTCTGGTCG
GCTGCCTACAACGTGTTGGCCGTGCTGCTGGCGTCAGGGGCGCTGGTCGCCGTTCGCATCCCGCCGGGCCTCGCC
GGCCTGGGAGAGTTCGTCAGTGTCTTGCCTGTCATTTTAGCGGCTGCTTCTATGCTTTGGAAGGGGATTCCGGCT
TATGGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail