Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02975
Gene name
Locationscaffold_03:290813..291571
Strand+
Gene length (bp)758
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10785 NADH-u_ox-rdase NADH-ubiquinone oxidoreductase complex I, 21 kDa subunit 7.8E-31 22 107
PF12853 NADH_u_ox_C C-terminal of NADH-ubiquinone oxidoreductase 21 kDa subunit 3.8E-24 116 188

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 45 62 17
2 77 95 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02975
MAETTIKRPPQTFVGASKVAQTDYPLIDNDPHFKRVVRYARPSDYVHGVVAAAFAPTAMLVMEKFAPSHVRKGGF
ARVMRLAGFIGIAGGFLYFYQRSCLRFYGATENAREIQMDMREMVDRVKAGLPIYGESKLAPHLQGVAARQSRYS
ALFFSVLPWFNFVNHNQHGVDTAKYYQQAERELEMERTASGS*
Coding >Ophcf2|02975
ATGGCCGAGACGACAATCAAGCGGCCTCCGCAGACGTTTGTGGGTGCGAGCAAAGTCGCGCAGACAGACTATCCG
CTCATCGACAACGACCCCCACTTCAAGCGTGTCGTCCGTTATGCCCGTCCGTCAGACTATGTCCATGGCGTCGTG
GCGGCTGCGTTCGCGCCCACGGCCATGCTGGTTATGGAGAAGTTTGCGCCCTCGCATGTCAGGAAGGGGGGTTTC
GCCAGGGTGATGCGGCTGGCGGGCTTCATCGGGATTGCCGGCGGATTTCTCTACTTTTATCAGCGGTCGTGCCTG
CGCTTCTACGGTGCGACGGAGAACGCGCGCGAGATCCAAATGGACATGCGCGAAATGGTGGATAGGGTCAAGGCC
GGTTTGCCGATATATGGGGAGAGCAAGCTGGCGCCGCACTTGCAAGGCGTGGCGGCGCGCCAGAGCCGCTACTCG
GCTCTCTTCTTCAGCGTGCTCCCGTGGTTCAACTTTGTCAACCACAACCAGCACGGCGTCGACACGGCCAAGTAC
TATCAACAGGCGGAACGCGAGTTGGAGATGGAGCGGACGGCCAGCGGATCGTGA
Transcript >Ophcf2|02975
ATGGCCGAGACGACAATCAAGCGGCCTCCGCAGACGTTTGTGGGTGCGAGCAAAGTCGCGCAGACAGACTATCCG
CTCATCGACAACGACCCCCACTTCAAGCGTGTCGTCCGTTATGCCCGTCCGTCAGACTATGTCCATGGCGTCGTG
GCGGCTGCGTTCGCGCCCACGGCCATGCTGGTTATGGAGAAGTTTGCGCCCTCGCATGTCAGGAAGGGGGGTTTC
GCCAGGGTGATGCGGCTGGCGGGCTTCATCGGGATTGCCGGCGGATTTCTCTACTTTTATCAGCGGTCGTGCCTG
CGCTTCTACGGTGCGACGGAGAACGCGCGCGAGATCCAAATGGACATGCGCGAAATGGTGGATAGGGTCAAGGCC
GGTTTGCCGATATATGGGGAGAGCAAGCTGGCGCCGCACTTGCAAGGCGTGGCGGCGCGCCAGAGCCGCTACTCG
GCTCTCTTCTTCAGCGTGCTCCCGTGGTTCAACTTTGTCAACCACAACCAGCACGGCGTCGACACGGCCAAGTAC
TATCAACAGGCGGAACGCGAGTTGGAGATGGAGCGGACGGCCAGCGGATCGTGA
Gene >Ophcf2|02975
ATGGCCGAGACGACAATCAAGCGGCCTCCGCAGACGTTTGTGGGTGCGAGCAAAGTCGCGCAGACAGACTATCCG
GTACGGATGTTCCTCGAATAGAGGGTAGTTGGCGCAGCTAACTCATCAGGGCGCAGCTCATCGACAACGACCCGT
ACGTGTCCCATTGGGCAAGCGAGATGGATGCCTCGTCGTTCTCTGACCCCTCAGCAGCCACTTCAAGCGTGTCGT
CCGTTATGCCCGTCCGTCAGACTATGTCCATGGCGTCGTGGCGGCTGCGTTCGCGCCCACGGCCATGCTGGTTAT
GGAGAAGTTTGCGCCCTCGCATGTCAGGAAGGGGGGTTTCGCCAGGGTGATGCGGCTGGCGGGCTTCATCGGGAT
TGCCGGCGGATTTCTCTACTTTTATCAGCGGTCGTGCCGTGAGTGCCACCCTCCTGTTTGCCCCCCCCCCCCATC
AGGCGTGCTGACAGCCAACTCGACCAGTGCGCTTCTACGGTGCGACGGAGAACGCGCGCGAGATCCAAATGGACA
TGCGCGAAATGGTGGATAGGGTCAAGGCCGGTTTGCCGATATATGGGGAGAGCAAGCTGGCGCCGCACTTGCAAG
GCGTGGCGGCGCGCCAGAGCCGCTACTCGGCTCTCTTCTTCAGCGTGCTCCCGTGGTTCAACTTTGTCAACCACA
ACCAGCACGGCGTCGACACGGCCAAGTACTATCAACAGGCGGAACGCGAGTTGGAGATGGAGCGGACGGCCAGCG
GATCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail