Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02972
Gene name
Locationscaffold_03:283126..285096
Strand-
Gene length (bp)1970
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 2.1E-61 22 329
PF05199 GMC_oxred_C GMC oxidoreductase 1.4E-33 455 598

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.4225 0.4254 0.487 0.0225 0.2673 0.0144 0.0254 0.1903 0.0899 0.2664

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA3_2 3.8E-183 21 605

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2005
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7622
Ophiocordyceps australis map64 (Brazil) OphauB2|1283
Ophiocordyceps camponoti-floridani Ophcf2|02972 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3006
Ophiocordyceps kimflemingae Ophio5|5620
Ophiocordyceps subramaniannii Hirsu2|2250

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02972
MADPQTKKPRLSAGDDFVKRRFDYLIVGGGTAGLALAARLAIGAPSAIVGVVEAGSVSSDEQDVDIPAFFGRSIG
GRHDWRYETEPQPGLRGRSVPWPRGRVLGGTSALNYMAWNRANKADYDAWEALGNTGWGWDDLLPFFKKSETFSP
PSHTAVDDDANISYDPSLFGSSGPIRVSYTAHFSPSHRLWHRTLHALGLETNPAPVGGSNTGVWTCAQAIDPEEK
TRSYSTSYCASSPPNLLILTDATVNRVILAPYAAGYRATGLRLTCDGTEHLVTAAREVILSAGSIGSPQILELSG
IGNRHVLSRAGIPVKVDSPRVGENLQDHMMLALVFEVDPSLENPDELKRDAFAAAAAMDQYIRDRGGPLTALPSA
FAYVPLSHFVPQETLACLSSRAGNLAGMDADKRRILQRRLDKPPKLGHIEYIFELGNWSPNFTPEMGKQYGTLLQ
ILQYPFSVGSVHIRPGASGDKPTIDPQYYGGPHGQLDLETMKLCLSFARRIVSEKPLAGIIKGPAWPTASTMSDE
QSMEDWIREATLTDWHPVGTCSMGGRAGIEGGVVDERLRVFGVEGLRVVDASVMPLQISAHPQATVYAIAEKAAH
MVLEDMRGSVARL*
Coding >Ophcf2|02972
ATGGCCGACCCTCAAACGAAAAAGCCTCGTCTCTCGGCCGGCGACGACTTCGTCAAGCGCCGCTTCGACTATCTC
ATCGTCGGAGGTGGAACGGCGGGCCTCGCTCTAGCCGCTCGACTCGCCATCGGGGCTCCTTCGGCCATCGTCGGC
GTCGTCGAGGCCGGTTCCGTCTCCAGCGACGAGCAGGACGTCGACATCCCGGCCTTCTTTGGTCGCTCCATCGGC
GGCCGCCATGACTGGCGTTATGAAACGGAACCCCAGCCAGGGCTGAGAGGCCGTTCCGTACCCTGGCCCCGCGGC
AGGGTCCTGGGCGGCACCAGCGCCCTCAACTACATGGCCTGGAACCGAGCCAACAAGGCCGATTACGACGCCTGG
GAGGCCCTCGGAAACACAGGCTGGGGATGGGACGACTTGCTCCCCTTTTTCAAGAAATCCGAGACCTTCTCTCCA
CCCTCCCATACGGCGGTCGATGACGACGCCAACATCTCGTATGATCCCAGCCTCTTCGGTTCCTCTGGCCCCATC
CGCGTCTCGTACACTGCACACTTTTCGCCCTCGCACCGCCTTTGGCATCGGACCCTCCACGCCCTTGGCCTCGAA
ACCAACCCGGCCCCTGTCGGAGGATCCAATACTGGCGTATGGACCTGTGCCCAAGCCATCGACCCCGAGGAGAAG
ACCCGATCGTATTCGACGAGCTACTGCGCGTCTTCGCCACCCAACTTGCTCATTCTGACTGATGCCACCGTCAAC
CGGGTCATTCTCGCGCCGTATGCCGCCGGCTATCGGGCCACGGGCCTGCGGCTGACATGTGACGGCACCGAGCAC
CTGGTAACTGCGGCCCGCGAGGTCATCCTGTCGGCCGGCTCCATTGGTTCGCCCCAGATTCTCGAGCTGTCGGGC
ATCGGCAACCGTCATGTCTTGTCCAGGGCTGGGATACCCGTCAAGGTTGATAGTCCCAGGGTTGGGGAGAACCTT
CAGGATCACATGATGCTGGCTCTCGTCTTTGAAGTCGACCCGAGCCTCGAGAATCCCGATGAGCTCAAGCGAGAC
GCCTTTGCCGCGGCGGCAGCCATGGACCAATACATTAGGGATCGTGGGGGTCCGTTGACGGCGCTTCCTAGCGCC
TTTGCGTACGTTCCCCTCAGTCATTTCGTGCCGCAAGAGACGCTGGCCTGCCTGTCCTCGAGGGCTGGCAACCTG
GCCGGCATGGATGCCGACAAGAGGCGGATCCTGCAACGGCGGCTCGACAAGCCACCTAAACTCGGCCACATCGAG
TACATCTTTGAACTCGGCAACTGGAGCCCCAATTTCACCCCGGAGATGGGCAAGCAGTACGGAACCTTGCTTCAG
ATCCTGCAATATCCCTTCTCCGTCGGCTCCGTTCACATCCGACCCGGGGCTAGCGGCGACAAGCCCACCATCGAC
CCGCAATACTATGGCGGACCCCACGGACAGCTTGATCTGGAGACGATGAAGCTGTGTCTGAGTTTCGCGAGACGC
ATCGTGTCCGAGAAGCCGCTCGCCGGCATCATCAAGGGGCCTGCGTGGCCGACGGCATCGACGATGAGCGATGAG
CAGAGCATGGAGGACTGGATCAGGGAAGCCACGTTGACGGACTGGCATCCCGTAGGCACTTGCAGCATGGGCGGA
CGGGCAGGCATCGAGGGGGGTGTCGTGGACGAGAGGCTGCGCGTGTTTGGCGTCGAGGGTCTTCGGGTGGTGGAC
GCGAGCGTGATGCCGCTGCAGATCAGCGCGCATCCGCAGGCGACAGTGTACGCCATTGCCGAGAAGGCGGCTCAC
ATGGTGCTGGAGGACATGAGGGGGTCTGTTGCACGGTTATGA
Transcript >Ophcf2|02972
ATGGCCGACCCTCAAACGAAAAAGCCTCGTCTCTCGGCCGGCGACGACTTCGTCAAGCGCCGCTTCGACTATCTC
ATCGTCGGAGGTGGAACGGCGGGCCTCGCTCTAGCCGCTCGACTCGCCATCGGGGCTCCTTCGGCCATCGTCGGC
GTCGTCGAGGCCGGTTCCGTCTCCAGCGACGAGCAGGACGTCGACATCCCGGCCTTCTTTGGTCGCTCCATCGGC
GGCCGCCATGACTGGCGTTATGAAACGGAACCCCAGCCAGGGCTGAGAGGCCGTTCCGTACCCTGGCCCCGCGGC
AGGGTCCTGGGCGGCACCAGCGCCCTCAACTACATGGCCTGGAACCGAGCCAACAAGGCCGATTACGACGCCTGG
GAGGCCCTCGGAAACACAGGCTGGGGATGGGACGACTTGCTCCCCTTTTTCAAGAAATCCGAGACCTTCTCTCCA
CCCTCCCATACGGCGGTCGATGACGACGCCAACATCTCGTATGATCCCAGCCTCTTCGGTTCCTCTGGCCCCATC
CGCGTCTCGTACACTGCACACTTTTCGCCCTCGCACCGCCTTTGGCATCGGACCCTCCACGCCCTTGGCCTCGAA
ACCAACCCGGCCCCTGTCGGAGGATCCAATACTGGCGTATGGACCTGTGCCCAAGCCATCGACCCCGAGGAGAAG
ACCCGATCGTATTCGACGAGCTACTGCGCGTCTTCGCCACCCAACTTGCTCATTCTGACTGATGCCACCGTCAAC
CGGGTCATTCTCGCGCCGTATGCCGCCGGCTATCGGGCCACGGGCCTGCGGCTGACATGTGACGGCACCGAGCAC
CTGGTAACTGCGGCCCGCGAGGTCATCCTGTCGGCCGGCTCCATTGGTTCGCCCCAGATTCTCGAGCTGTCGGGC
ATCGGCAACCGTCATGTCTTGTCCAGGGCTGGGATACCCGTCAAGGTTGATAGTCCCAGGGTTGGGGAGAACCTT
CAGGATCACATGATGCTGGCTCTCGTCTTTGAAGTCGACCCGAGCCTCGAGAATCCCGATGAGCTCAAGCGAGAC
GCCTTTGCCGCGGCGGCAGCCATGGACCAATACATTAGGGATCGTGGGGGTCCGTTGACGGCGCTTCCTAGCGCC
TTTGCGTACGTTCCCCTCAGTCATTTCGTGCCGCAAGAGACGCTGGCCTGCCTGTCCTCGAGGGCTGGCAACCTG
GCCGGCATGGATGCCGACAAGAGGCGGATCCTGCAACGGCGGCTCGACAAGCCACCTAAACTCGGCCACATCGAG
TACATCTTTGAACTCGGCAACTGGAGCCCCAATTTCACCCCGGAGATGGGCAAGCAGTACGGAACCTTGCTTCAG
ATCCTGCAATATCCCTTCTCCGTCGGCTCCGTTCACATCCGACCCGGGGCTAGCGGCGACAAGCCCACCATCGAC
CCGCAATACTATGGCGGACCCCACGGACAGCTTGATCTGGAGACGATGAAGCTGTGTCTGAGTTTCGCGAGACGC
ATCGTGTCCGAGAAGCCGCTCGCCGGCATCATCAAGGGGCCTGCGTGGCCGACGGCATCGACGATGAGCGATGAG
CAGAGCATGGAGGACTGGATCAGGGAAGCCACGTTGACGGACTGGCATCCCGTAGGCACTTGCAGCATGGGCGGA
CGGGCAGGCATCGAGGGGGGTGTCGTGGACGAGAGGCTGCGCGTGTTTGGCGTCGAGGGTCTTCGGGTGGTGGAC
GCGAGCGTGATGCCGCTGCAGATCAGCGCGCATCCGCAGGCGACAGTGTACGCCATTGCCGAGAAGGCGGCTCAC
ATGGTGCTGGAGGACATGAGGGGGTCTGTTGCACGGTTATGA
Gene >Ophcf2|02972
ATGGCCGACCCTCAAACGAAAAAGCCTCGTCTCTCGGCCGGCGACGACTTCGTCAAGCGCCGCTTCGACTATCTC
ATCGTCGGAGGTGGAACGGCGGGCCTCGCTCTAGCCGCTCGACTCGCCATCGGGGCTCCTTCGGCCATCGTCGGC
GTCGTCGAGGCCGGTTCCGTCTCCAGCGACGAGCAGGACGTCGACATCCCGGCCTTCTTTGGTCGCTCCATCGGC
GGCCGCCATGACTGGCGTTATGAAACGGAACCCCAGCCAGGGCTGAGAGGCCGTTCCGTACCCTGGCCCCGCGGC
AGGGTCCTGGGCGGCACCAGCGCCCTCAACTACATGGCCTGGAACCGAGCCAACAAGGCCGATTACGACGCCTGG
GAGGCCCTCGGAAACACAGGCTGGGGATGGGACGACTTGCTGTGAGTCTGCCCTTTGTTTTGTTTCGGCACGTCA
TGAGTCGTCGGCCTGATATGTCCTCACATGCATACATACATACAGCCCCTTTTTCAAGAAATCCGAGACCTTCTC
TCCACCCTCCCATACGGCGGTCGATGACGACGCCAACATCTCGTATGATCCCAGCCTCTTCGGTTCCTCTGGCCC
CATCCGCGTCTCGTACACTGCACACTTTTCGCCCTCGCACCGCCTTTGGCATCGGACCCTCCACGCCCTTGGCCT
CGAAACCAACCCGGCCCCTGTCGGAGGATCCAATACTGGCGTATGGACCTGTGCCCAAGCCATCGACCCCGAGGA
GAAGACCCGATCGTATTCGACGAGCTACTGCGCGTCTTCGCCACCCAACTTGCTCATTCTGACTGATGCCACCGT
CAACCGGGTCATTCTCGCGCCGTATGCCGCCGGCTATCGGGCCACGGGCCTGCGGCTGACATGTGACGGCACCGA
GCACCTGGTAACTGCGGCCCGCGAGGTCATCCTGTCGGCCGGCTCCATTGGTTCGCCCCAGATTCTCGAGCTGTC
GGGCATCGGCAACCGTCATGTCTTGTCCAGGGCTGGGATACCCGTCAAGGTTGATAGTCCCAGGGTTGGGGAGAA
CCTTCAGGATCACATGAGTAAGGAGTCGCGACTACTATCCGAGTTCTCGCTGACCAGACCATCCAGTGCTGGCTC
TCGTCTTTGAAGTCGACCCGAGCCTCGAGAATCCCGATGAGCTCAAGCGAGACGCCTTTGCCGCGGCGGCAGCCA
TGGACCAATACATTAGGGATCGTGGGGGTCCGTTGACGGCGCTTCCTAGCGCCTTTGCGTACGTTCCCCTCAGTC
ATTTCGTGCCGCAAGAGACGCTGGCCTGCCTGTCCTCGAGGGCTGGCAACCTGGCCGGCATGGATGCCGACAAGA
GGCGGATCCTGCAACGGCGGCTCGACAAGCCACCTAAACTCGGCCACATCGAGTACATCTTTGAACTCGGCAACT
GGAGCCCCAATTTCACCCCGGAGATGGGCAAGCAGTACGGAACCTTGCTTCAGATCCTGCAATATCCCTTCTCCG
TCGGCTCCGTTCACATCCGACCCGGGGCTAGCGGCGACAAGCCCACCATCGACCCGCAATACTATGGCGGACCCC
ACGGACAGCTTGATCTGGAGACGATGAAGCTGTGTCTGAGTTTCGCGAGACGCATCGTGTCCGAGAAGCCGCTCG
CCGGCATCATCAAGGGGCCTGCGTGGCCGACGGCATCGACGATGAGCGATGAGCAGAGCATGGAGGACTGGATCA
GGGAAGCCACGTTGACGGACTGGCATCCCGTAGGCACTTGCAGCATGGGCGGACGGGCAGGCATCGAGGGGGGTG
TCGTGGACGAGAGGCTGCGCGTGTTTGGCGTCGAGGGTCTTCGGGTGGTGGACGCGAGCGTGATGCCGCTGCAGA
TCAGCGCGCATCCGCAGGCGACAGTGTACGCCATTGCCGAGAAGGCGGCTCACATGGTGCTGGAGGACATGAGGG
GGTCTGTTGCACGGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail