Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02971
Gene name
Locationscaffold_03:281040..282476
Strand+
Gene length (bp)1436
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 4.0E-22 2 416

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 35 57 22
3 78 97 19
4 112 134 22
5 141 160 19
6 180 202 22
7 211 233 22
8 270 292 22
9 305 322 17
10 327 349 22
11 371 390 19
12 405 427 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 5.23 1.41 9.05
Alive In ants, during behavior modification 994.37 353.80 1634.94
Dead In ants, recently dead 916.82 318.17 1515.48

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.791811 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02971
MQVAVMWFSANISLNNLAAAMLGPLVLGLGFVDCALLAVAGALVGSLTTAYMSVWGPQSGNRTMVVLRFFMGYWP
SKLPCFLNVVLMVGYATIDGIIGGQVLSAVSGGTMSIVVGIVVVSVVCWVVAVFGMALFHHYERYAWIPQIIALF
VLVGVAGPHFDPSSTSKATGALLAAQRLSFFNICLYVPNSWAAAASDFYVYYPEKTSRTKIFSLTLIGIWTAFCL
VYLIAIGLGTGVANMPAWAEANALSSGALIVAGYEPLGGFGRLCAVVVALGVIANSIPSTYSAALGCQTLGRHGK
AVPRWLWSTLLVVVELVLAVAGREHLFLIFQNFLALMGYWVMIMVIIVLEEHLLFRRAHGFDWSRWEDRDYLPVG
WAALAAFLVGWVGAVLGMSQAWYVGPLAKLAATADVGLWIGSAFTLIVFPPLRRLELKRIGR*
Coding >Ophcf2|02971
ATGCAGGTGGCCGTCATGTGGTTCAGCGCCAACATCTCGTTGAATAACCTCGCGGCCGCCATGCTGGGACCCTTG
GTTTTGGGGCTGGGCTTTGTGGATTGTGCGCTTTTGGCCGTTGCCGGCGCTTTGGTTGGGAGCTTGACGACGGCT
TATATGAGTGTTTGGGGGCCGCAGAGCGGGAATCGGACCATGGTTGTTCTTCGCTTCTTTATGGGTTATTGGCCT
TCGAAGCTCCCTTGCTTCCTCAACGTTGTTCTCATGGTTGGCTACGCTACCATCGACGGCATCATCGGTGGTCAA
GTCCTCTCAGCCGTTAGCGGAGGAACCATGAGCATCGTCGTTGGCATCGTCGTCGTCTCTGTTGTCTGCTGGGTC
GTCGCCGTCTTTGGCATGGCCCTCTTCCACCACTACGAACGATACGCCTGGATCCCTCAAATCATCGCTCTGTTC
GTCCTCGTGGGCGTTGCGGGCCCTCACTTTGATCCCTCTTCCACCTCCAAGGCAACGGGAGCCCTCCTCGCTGCT
CAACGCCTCTCCTTCTTCAACATCTGCTTATACGTGCCCAACTCATGGGCAGCCGCCGCGTCCGATTTCTACGTC
TACTACCCTGAGAAGACGTCACGCACCAAGATCTTCAGCCTTACTCTCATCGGCATCTGGACCGCCTTCTGCCTC
GTCTACCTCATCGCCATTGGCCTCGGCACCGGCGTTGCCAATATGCCGGCTTGGGCAGAAGCCAACGCCCTCAGC
TCGGGAGCTCTCATTGTTGCCGGTTATGAACCCCTTGGCGGCTTCGGTCGGTTATGTGCTGTCGTCGTTGCTCTC
GGCGTCATAGCAAACTCCATTCCGAGCACCTACTCGGCCGCTCTCGGCTGTCAGACTCTGGGTCGTCATGGCAAA
GCCGTCCCCCGCTGGTTATGGTCGACTCTTCTCGTCGTCGTCGAGCTCGTCCTGGCCGTCGCGGGCCGCGAGCAC
CTCTTCCTCATCTTCCAGAACTTCCTGGCTCTCATGGGCTACTGGGTCATGATCATGGTCATCATCGTCCTCGAG
GAACACCTCCTCTTCCGCCGCGCTCATGGCTTCGACTGGTCCCGTTGGGAAGATCGCGACTATCTGCCCGTCGGT
TGGGCCGCCCTCGCCGCCTTTCTCGTCGGCTGGGTTGGTGCTGTTCTCGGTATGAGTCAGGCCTGGTATGTAGGG
CCGCTGGCCAAGCTGGCTGCCACGGCCGATGTTGGACTGTGGATTGGCAGCGCATTTACACTGATTGTGTTTCCG
CCGCTGCGTCGTCTGGAGCTGAAGCGGATCGGCCGTTGA
Transcript >Ophcf2|02971
ATGCAGGTGGCCGTCATGTGGTTCAGCGCCAACATCTCGTTGAATAACCTCGCGGCCGCCATGCTGGGACCCTTG
GTTTTGGGGCTGGGCTTTGTGGATTGTGCGCTTTTGGCCGTTGCCGGCGCTTTGGTTGGGAGCTTGACGACGGCT
TATATGAGTGTTTGGGGGCCGCAGAGCGGGAATCGGACCATGGTTGTTCTTCGCTTCTTTATGGGTTATTGGCCT
TCGAAGCTCCCTTGCTTCCTCAACGTTGTTCTCATGGTTGGCTACGCTACCATCGACGGCATCATCGGTGGTCAA
GTCCTCTCAGCCGTTAGCGGAGGAACCATGAGCATCGTCGTTGGCATCGTCGTCGTCTCTGTTGTCTGCTGGGTC
GTCGCCGTCTTTGGCATGGCCCTCTTCCACCACTACGAACGATACGCCTGGATCCCTCAAATCATCGCTCTGTTC
GTCCTCGTGGGCGTTGCGGGCCCTCACTTTGATCCCTCTTCCACCTCCAAGGCAACGGGAGCCCTCCTCGCTGCT
CAACGCCTCTCCTTCTTCAACATCTGCTTATACGTGCCCAACTCATGGGCAGCCGCCGCGTCCGATTTCTACGTC
TACTACCCTGAGAAGACGTCACGCACCAAGATCTTCAGCCTTACTCTCATCGGCATCTGGACCGCCTTCTGCCTC
GTCTACCTCATCGCCATTGGCCTCGGCACCGGCGTTGCCAATATGCCGGCTTGGGCAGAAGCCAACGCCCTCAGC
TCGGGAGCTCTCATTGTTGCCGGTTATGAACCCCTTGGCGGCTTCGGTCGGTTATGTGCTGTCGTCGTTGCTCTC
GGCGTCATAGCAAACTCCATTCCGAGCACCTACTCGGCCGCTCTCGGCTGTCAGACTCTGGGTCGTCATGGCAAA
GCCGTCCCCCGCTGGTTATGGTCGACTCTTCTCGTCGTCGTCGAGCTCGTCCTGGCCGTCGCGGGCCGCGAGCAC
CTCTTCCTCATCTTCCAGAACTTCCTGGCTCTCATGGGCTACTGGGTCATGATCATGGTCATCATCGTCCTCGAG
GAACACCTCCTCTTCCGCCGCGCTCATGGCTTCGACTGGTCCCGTTGGGAAGATCGCGACTATCTGCCCGTCGGT
TGGGCCGCCCTCGCCGCCTTTCTCGTCGGCTGGGTTGGTGCTGTTCTCGGTATGAGTCAGGCCTGGTATGTAGGG
CCGCTGGCCAAGCTGGCTGCCACGGCCGATGTTGGACTGTGGATTGGCAGCGCATTTACACTGATTGTGTTTCCG
CCGCTGCGTCGTCTGGAGCTGAAGCGGATCGGCCGTTGA
Gene >Ophcf2|02971
ATGCAGGTGGCCGTCATGTGGTTCAGCGCCAACATCTCGTTGAATAACCTCGCGGCCGCCATGCTGGGACCCTTG
GTTTTGGGGCTGGGCTTTGTGGATTGTGCGCTTTTGGCCGTTGCCGGCGCTTTGGTTGGGAGCTTGACGACGGCT
TATATGAGTGTTTGGGGGCCGCAGAGCGGGAATCGGACCATGGTGAGTTGGGGGGTTATCTTGGTGTGAGTTCTC
CGGGGGGGTGTGGGAATGTCTTCTAACTGCTTAGGTTGTTCTTCGCTTCTTTATGGGTTATTGGCCTTCGAAGCT
CCCTTGCTTCCTCAACGTTGTTCTCATGGTTGGCTACGCTACCATCGACGGCATCATCGGTGGTCAAGTCCTCTC
AGCCGTTAGCGGAGGAACCATGAGCATCGTCGTTGGCATCGTCGTCGTCTCTGTTGTCTGCTGGGTCGTCGCCGT
CTTTGGCATGGCCCTCTTCCACCACTACGAACGGTAGGAATCTTCTTCCCCTTTCATCGTTTTACACCGAGACTC
ACAAAGCTACAAGATACGCCTGGATCCCTCAAATCATCGCTCTGTTCGTCCTCGTGGGCGTTGCGGGCCCTCACT
TTGATCCCTCTTCCACCTCCAAGGCAACGGGAGCCCTCCTCGCTGCTCAACGCCTCTCCTTCTTCAACATCTGCT
TATACGTGCCCAACTCATGGGCAGCCGCCGCGTCCGATTTCTACGTCTACTACCCTGAGAAGACGTCACGCACCA
AGATCTTCAGCCTTACTCTCATCGGCATCTGGACCGCCTTCTGCCTCGTCTACCTCATCGCCATTGGCCTCGGCA
CCGGCGTTGCCAATATGCCGGCTTGGGCAGAAGCCAACGCCCTCAGCTCGGGAGCTCTCATTGTTGCCGGTTATG
AACCCCTTGGCGGCTTCGGTCGGTTATGTGCTGTCGTCGTTGCTCTCGGCGTCATAGCAAACTCCATTCCGAGCA
CCTACTCGGCCGCTCTCGGCTGTCAGACTCTGGGTCGTCATGGCAAAGCCGTCCCCCGCTGGTTATGGTCGACTC
TTCTCGTCGTCGTCGAGCTCGTCCTGGCCGTCGCGGGCCGCGAGCACCTCTTCCTCATCTTCCAGAACTTCCTGG
CTCTCATGGGCTACTGGGTCATGATCATGGTCATCATCGTCCTCGAGGAACACCTCCTCTTCCGCCGCGCTCATG
GCTTCGACTGGTCCCGTTGGGAAGATCGCGACTATCTGCCCGTCGGTTGGGCCGCCCTCGCCGCCTTTCTCGTCG
GCTGGGTTGGTGCTGTTCTCGGTATGAGTCAGGCCTGGTATGTAGGGCCGCTGGCCAAGCTGGCTGCCACGGCCG
ATGTTGGACTGTGGATTGGCAGCGCATTTACACTGATTGTGTTTCCGCCGCTGCGTCGTCTGGAGCTGAAGCGGA
TCGGCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail