Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02971
Gene name
Locationscaffold_03:281040..282476
Strand+
Gene length (bp)1436
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 4.0E-22 2 416

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.0973 0.0953 0.0423 0.2482 0.1889 0.0035 0.284 0.6718 0.5886 0.0513

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 35 57 22
3 78 97 19
4 112 134 22
5 141 160 19
6 180 202 22
7 211 233 22
8 270 292 22
9 305 322 17
10 327 349 22
11 371 390 19
12 405 427 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2004
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1732
Ophiocordyceps australis map64 (Brazil) OphauB2|470
Ophiocordyceps camponoti-floridani Ophcf2|02971 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3007
Ophiocordyceps kimflemingae Ophio5|5619
Ophiocordyceps subramaniannii Hirsu2|2249

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02971
MQVAVMWFSANISLNNLAAAMLGPLVLGLGFVDCALLAVAGALVGSLTTAYMSVWGPQSGNRTMVVLRFFMGYWP
SKLPCFLNVVLMVGYATIDGIIGGQVLSAVSGGTMSIVVGIVVVSVVCWVVAVFGMALFHHYERYAWIPQIIALF
VLVGVAGPHFDPSSTSKATGALLAAQRLSFFNICLYVPNSWAAAASDFYVYYPEKTSRTKIFSLTLIGIWTAFCL
VYLIAIGLGTGVANMPAWAEANALSSGALIVAGYEPLGGFGRLCAVVVALGVIANSIPSTYSAALGCQTLGRHGK
AVPRWLWSTLLVVVELVLAVAGREHLFLIFQNFLALMGYWVMIMVIIVLEEHLLFRRAHGFDWSRWEDRDYLPVG
WAALAAFLVGWVGAVLGMSQAWYVGPLAKLAATADVGLWIGSAFTLIVFPPLRRLELKRIGR*
Coding >Ophcf2|02971
ATGCAGGTGGCCGTCATGTGGTTCAGCGCCAACATCTCGTTGAATAACCTCGCGGCCGCCATGCTGGGACCCTTG
GTTTTGGGGCTGGGCTTTGTGGATTGTGCGCTTTTGGCCGTTGCCGGCGCTTTGGTTGGGAGCTTGACGACGGCT
TATATGAGTGTTTGGGGGCCGCAGAGCGGGAATCGGACCATGGTTGTTCTTCGCTTCTTTATGGGTTATTGGCCT
TCGAAGCTCCCTTGCTTCCTCAACGTTGTTCTCATGGTTGGCTACGCTACCATCGACGGCATCATCGGTGGTCAA
GTCCTCTCAGCCGTTAGCGGAGGAACCATGAGCATCGTCGTTGGCATCGTCGTCGTCTCTGTTGTCTGCTGGGTC
GTCGCCGTCTTTGGCATGGCCCTCTTCCACCACTACGAACGATACGCCTGGATCCCTCAAATCATCGCTCTGTTC
GTCCTCGTGGGCGTTGCGGGCCCTCACTTTGATCCCTCTTCCACCTCCAAGGCAACGGGAGCCCTCCTCGCTGCT
CAACGCCTCTCCTTCTTCAACATCTGCTTATACGTGCCCAACTCATGGGCAGCCGCCGCGTCCGATTTCTACGTC
TACTACCCTGAGAAGACGTCACGCACCAAGATCTTCAGCCTTACTCTCATCGGCATCTGGACCGCCTTCTGCCTC
GTCTACCTCATCGCCATTGGCCTCGGCACCGGCGTTGCCAATATGCCGGCTTGGGCAGAAGCCAACGCCCTCAGC
TCGGGAGCTCTCATTGTTGCCGGTTATGAACCCCTTGGCGGCTTCGGTCGGTTATGTGCTGTCGTCGTTGCTCTC
GGCGTCATAGCAAACTCCATTCCGAGCACCTACTCGGCCGCTCTCGGCTGTCAGACTCTGGGTCGTCATGGCAAA
GCCGTCCCCCGCTGGTTATGGTCGACTCTTCTCGTCGTCGTCGAGCTCGTCCTGGCCGTCGCGGGCCGCGAGCAC
CTCTTCCTCATCTTCCAGAACTTCCTGGCTCTCATGGGCTACTGGGTCATGATCATGGTCATCATCGTCCTCGAG
GAACACCTCCTCTTCCGCCGCGCTCATGGCTTCGACTGGTCCCGTTGGGAAGATCGCGACTATCTGCCCGTCGGT
TGGGCCGCCCTCGCCGCCTTTCTCGTCGGCTGGGTTGGTGCTGTTCTCGGTATGAGTCAGGCCTGGTATGTAGGG
CCGCTGGCCAAGCTGGCTGCCACGGCCGATGTTGGACTGTGGATTGGCAGCGCATTTACACTGATTGTGTTTCCG
CCGCTGCGTCGTCTGGAGCTGAAGCGGATCGGCCGTTGA
Transcript >Ophcf2|02971
ATGCAGGTGGCCGTCATGTGGTTCAGCGCCAACATCTCGTTGAATAACCTCGCGGCCGCCATGCTGGGACCCTTG
GTTTTGGGGCTGGGCTTTGTGGATTGTGCGCTTTTGGCCGTTGCCGGCGCTTTGGTTGGGAGCTTGACGACGGCT
TATATGAGTGTTTGGGGGCCGCAGAGCGGGAATCGGACCATGGTTGTTCTTCGCTTCTTTATGGGTTATTGGCCT
TCGAAGCTCCCTTGCTTCCTCAACGTTGTTCTCATGGTTGGCTACGCTACCATCGACGGCATCATCGGTGGTCAA
GTCCTCTCAGCCGTTAGCGGAGGAACCATGAGCATCGTCGTTGGCATCGTCGTCGTCTCTGTTGTCTGCTGGGTC
GTCGCCGTCTTTGGCATGGCCCTCTTCCACCACTACGAACGATACGCCTGGATCCCTCAAATCATCGCTCTGTTC
GTCCTCGTGGGCGTTGCGGGCCCTCACTTTGATCCCTCTTCCACCTCCAAGGCAACGGGAGCCCTCCTCGCTGCT
CAACGCCTCTCCTTCTTCAACATCTGCTTATACGTGCCCAACTCATGGGCAGCCGCCGCGTCCGATTTCTACGTC
TACTACCCTGAGAAGACGTCACGCACCAAGATCTTCAGCCTTACTCTCATCGGCATCTGGACCGCCTTCTGCCTC
GTCTACCTCATCGCCATTGGCCTCGGCACCGGCGTTGCCAATATGCCGGCTTGGGCAGAAGCCAACGCCCTCAGC
TCGGGAGCTCTCATTGTTGCCGGTTATGAACCCCTTGGCGGCTTCGGTCGGTTATGTGCTGTCGTCGTTGCTCTC
GGCGTCATAGCAAACTCCATTCCGAGCACCTACTCGGCCGCTCTCGGCTGTCAGACTCTGGGTCGTCATGGCAAA
GCCGTCCCCCGCTGGTTATGGTCGACTCTTCTCGTCGTCGTCGAGCTCGTCCTGGCCGTCGCGGGCCGCGAGCAC
CTCTTCCTCATCTTCCAGAACTTCCTGGCTCTCATGGGCTACTGGGTCATGATCATGGTCATCATCGTCCTCGAG
GAACACCTCCTCTTCCGCCGCGCTCATGGCTTCGACTGGTCCCGTTGGGAAGATCGCGACTATCTGCCCGTCGGT
TGGGCCGCCCTCGCCGCCTTTCTCGTCGGCTGGGTTGGTGCTGTTCTCGGTATGAGTCAGGCCTGGTATGTAGGG
CCGCTGGCCAAGCTGGCTGCCACGGCCGATGTTGGACTGTGGATTGGCAGCGCATTTACACTGATTGTGTTTCCG
CCGCTGCGTCGTCTGGAGCTGAAGCGGATCGGCCGTTGA
Gene >Ophcf2|02971
ATGCAGGTGGCCGTCATGTGGTTCAGCGCCAACATCTCGTTGAATAACCTCGCGGCCGCCATGCTGGGACCCTTG
GTTTTGGGGCTGGGCTTTGTGGATTGTGCGCTTTTGGCCGTTGCCGGCGCTTTGGTTGGGAGCTTGACGACGGCT
TATATGAGTGTTTGGGGGCCGCAGAGCGGGAATCGGACCATGGTGAGTTGGGGGGTTATCTTGGTGTGAGTTCTC
CGGGGGGGTGTGGGAATGTCTTCTAACTGCTTAGGTTGTTCTTCGCTTCTTTATGGGTTATTGGCCTTCGAAGCT
CCCTTGCTTCCTCAACGTTGTTCTCATGGTTGGCTACGCTACCATCGACGGCATCATCGGTGGTCAAGTCCTCTC
AGCCGTTAGCGGAGGAACCATGAGCATCGTCGTTGGCATCGTCGTCGTCTCTGTTGTCTGCTGGGTCGTCGCCGT
CTTTGGCATGGCCCTCTTCCACCACTACGAACGGTAGGAATCTTCTTCCCCTTTCATCGTTTTACACCGAGACTC
ACAAAGCTACAAGATACGCCTGGATCCCTCAAATCATCGCTCTGTTCGTCCTCGTGGGCGTTGCGGGCCCTCACT
TTGATCCCTCTTCCACCTCCAAGGCAACGGGAGCCCTCCTCGCTGCTCAACGCCTCTCCTTCTTCAACATCTGCT
TATACGTGCCCAACTCATGGGCAGCCGCCGCGTCCGATTTCTACGTCTACTACCCTGAGAAGACGTCACGCACCA
AGATCTTCAGCCTTACTCTCATCGGCATCTGGACCGCCTTCTGCCTCGTCTACCTCATCGCCATTGGCCTCGGCA
CCGGCGTTGCCAATATGCCGGCTTGGGCAGAAGCCAACGCCCTCAGCTCGGGAGCTCTCATTGTTGCCGGTTATG
AACCCCTTGGCGGCTTCGGTCGGTTATGTGCTGTCGTCGTTGCTCTCGGCGTCATAGCAAACTCCATTCCGAGCA
CCTACTCGGCCGCTCTCGGCTGTCAGACTCTGGGTCGTCATGGCAAAGCCGTCCCCCGCTGGTTATGGTCGACTC
TTCTCGTCGTCGTCGAGCTCGTCCTGGCCGTCGCGGGCCGCGAGCACCTCTTCCTCATCTTCCAGAACTTCCTGG
CTCTCATGGGCTACTGGGTCATGATCATGGTCATCATCGTCCTCGAGGAACACCTCCTCTTCCGCCGCGCTCATG
GCTTCGACTGGTCCCGTTGGGAAGATCGCGACTATCTGCCCGTCGGTTGGGCCGCCCTCGCCGCCTTTCTCGTCG
GCTGGGTTGGTGCTGTTCTCGGTATGAGTCAGGCCTGGTATGTAGGGCCGCTGGCCAAGCTGGCTGCCACGGCCG
ATGTTGGACTGTGGATTGGCAGCGCATTTACACTGATTGTGTTTCCGCCGCTGCGTCGTCTGGAGCTGAAGCGGA
TCGGCCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail