Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02968
Gene name
Locationscaffold_03:271194..275114
Strand+
Gene length (bp)3920
Transcript length (bp)3834
Coding sequence length (bp)3834
Protein length (aa) 1278

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08148 DSHCT DSHCT (NUC185) domain 5.9E-48 1101 1270
PF17911 Ski2_N Ski2 N-terminal region 1.9E-34 49 196
PF13234 rRNA_proc-arch rRNA-processing arch domain 1.0E-27 800 1074
PF00270 DEAD DEAD/DEAH box helicase 2.6E-16 300 446
PF00271 Helicase_C Helicase conserved C-terminal domain 4.2E-06 636 742

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5182 0.5331 0.0665 0.1349 0.1616 0.0393 0.0624 0.0292 0.0304 0.0062

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1918
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7082
Ophiocordyceps australis map64 (Brazil) OphauB2|466
Ophiocordyceps camponoti-floridani Ophcf2|02968 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6311
Ophiocordyceps kimflemingae Ophio5|6905
Ophiocordyceps subramaniannii Hirsu2|2020

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02968
MAAIDDLLLSQKPGDFVRRRPRDMVEVKRRLETQFLFPSAAFSTEWLNRLQQRWEFEADYPSLFSIAPPLTRTVT
RFLRRGLEGRVTGYENVTVPMNGATAKNSTSLLRKPAGRADFVRGAAGFFPFAPGGLEGIEATSALEDQVHAGVA
AVEDSGPRANKLERVIQLGSHGSLLEVAPGMDRGIDFDNKNDDSEDAKAIEQVLAEDPEDQDSKKDDEDGAPSQD
LPEDVTDRYEDGDEIDDILPVEFPSLEPRGVLAGSSARKAGREWAHMVDIKHGMPNFRELVPDMAREWPFELDTF
QKEAVYHLENGDSVFVAAHTSAGKTVVAEYAIALAARHMTKAIYTSPIKALSNQKFRDFRNDFGDVGILTGDVQI
NPEASCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDYERGVVWEEVIIMLPEHVSLILLSATVPNTYEFA
SWVGRTKQKDIYVISTSKRPVPLEHFLWAGKNVHRIVDADKNFVESGWRDAHSATRPKDKQRPAETSMAVRGGNA
RGGNSRGGQRGGGRGAGGPQRGGAGGQQRGRGGPPRASHAPGHMGRGGRAGGMTSAAQDKNLWVHLVQFLRKQSL
LPACIFVFSKKRCEENADALSNQDFCTASEKSHIHMIIERSIARLKPEDRVLPQIIRLKELLNRGIAVHHGGLLP
IVKELVEILFAQTLVKVLFATETFAMGLNLPTRTVVFSGYRKHDGHSFRNLLPGEYTQMAGRAGRRGLDTVGSVI
IVPPGGSDDVPPVAELRNMILGAPSKLRSQFRLTYNMILNLLRVEALKIEEMIKRSFSEHATQQLLPEHEKGVRL
AQADLAKVKRDACQLCDGAVDECHQAAQDYRQLTLELYKGLLRIVIGRKMFCPQRLVVFSWEGIRTAGLLVAEGM
SPRGSLEEPILQVCAVQPLRQQREAADLLPFVPAFRQYLHRLPQGKRKHESGMIRMKMVHVPLSDVECLTRWVLK
GTIPDVTRRGVVGQQAMERVREFCASWDNASDDRWDELDLGRIKSLQLQEMAEKRARLIKVMSASSATRCPNFVK
HFAMCHDEWLIKEHILQLKQSLSDQNLQLLPDYEQRVQVLKELGFVDEATRIQLKGKVACEVHSGDELVLTELIL
DNVLADFEPAEIAALLSSFVFQEKTLVEPALTSNLARGRDTIVAISEKVNDVQTRLQVIQSSDESNDFVSRPRFG
LMEVVYEWARGMSFKNITALTDVLEGTIVRTMTRLDETCREVKNAARIVGDPELYRKMQAAQDMIKRDITAVASL
YM*
Coding >Ophcf2|02968
ATGGCTGCAATAGACGACCTACTTCTATCGCAGAAGCCTGGCGATTTCGTCCGGCGTCGGCCTCGAGATATGGTC
GAGGTGAAGCGCCGTCTCGAGACCCAGTTTCTGTTTCCTTCAGCCGCATTCTCGACCGAGTGGCTCAACCGGCTG
CAGCAGCGATGGGAATTCGAAGCCGACTATCCCTCGCTCTTCAGTATTGCCCCGCCGCTGACTCGTACTGTCACT
CGATTTCTTCGTCGGGGGCTCGAGGGCAGGGTGACGGGCTACGAAAACGTGACGGTTCCGATGAACGGCGCCACG
GCCAAGAACTCGACCAGCCTGCTACGAAAGCCCGCGGGTCGTGCCGATTTTGTGAGGGGCGCTGCTGGATTCTTC
CCCTTTGCTCCCGGAGGGCTTGAAGGTATCGAGGCCACATCGGCTCTAGAGGACCAGGTTCATGCCGGTGTCGCC
GCCGTCGAAGACTCGGGCCCACGAGCAAACAAGCTCGAGAGGGTCATCCAACTCGGCTCTCATGGAAGTTTACTT
GAGGTTGCTCCCGGCATGGATCGAGGCATCGACTTTGATAACAAGAACGACGACAGCGAAGATGCAAAGGCCATC
GAGCAGGTGTTGGCGGAAGATCCCGAAGACCAAGATTCGAAGAAGGATGACGAAGATGGTGCCCCGTCTCAGGAT
TTGCCAGAAGACGTGACTGATCGATACGAGGACGGCGACGAAATCGACGACATCTTACCCGTCGAGTTCCCCTCG
CTCGAACCCCGAGGCGTGCTCGCGGGCTCCAGCGCCAGAAAGGCTGGCCGCGAATGGGCGCACATGGTGGACATC
AAGCACGGCATGCCCAATTTCAGAGAGCTGGTGCCTGACATGGCTCGAGAGTGGCCGTTTGAGCTCGACACTTTC
CAGAAAGAAGCCGTCTATCACCTCGAAAACGGGGATTCCGTCTTCGTCGCCGCTCATACGTCGGCGGGCAAGACG
GTCGTTGCCGAGTATGCAATTGCTCTGGCGGCCAGACACATGACCAAGGCCATCTATACGTCGCCCATCAAAGCA
CTCAGCAACCAAAAGTTTCGAGATTTCCGCAACGACTTTGGCGATGTCGGCATCCTGACGGGCGACGTCCAGATC
AACCCTGAGGCCAGCTGCCTCATCATGACGACGGAGATCCTTCGAAGCATGTTGTATCGGGGAGCAGACCTGATA
CGTGATGTCGAGTTTGTCATCTTTGACGAGGTGCACTATGTCAACGACTATGAGCGAGGCGTCGTCTGGGAAGAG
GTCATCATCATGCTGCCCGAGCACGTATCTCTCATTCTCTTGTCGGCGACGGTCCCCAATACCTACGAATTTGCC
TCGTGGGTCGGCAGGACCAAGCAAAAGGACATTTACGTCATATCGACCTCGAAGCGGCCGGTGCCCCTGGAGCAC
TTCCTCTGGGCCGGCAAGAATGTCCACAGGATCGTTGATGCAGACAAGAACTTTGTGGAGAGCGGATGGAGGGAC
GCTCACAGCGCCACTCGACCCAAAGACAAGCAGAGGCCGGCAGAGACGTCGATGGCCGTCCGGGGGGGCAACGCT
CGAGGCGGCAACTCCCGGGGCGGACAGCGGGGCGGAGGCCGGGGCGCCGGCGGACCGCAGCGCGGAGGAGCCGGC
GGACAGCAAAGAGGACGCGGCGGTCCTCCTCGGGCCAGCCATGCTCCCGGTCACATGGGCAGAGGCGGCCGTGCC
GGAGGCATGACGTCGGCGGCTCAGGATAAGAATTTATGGGTTCATCTGGTGCAGTTCCTCCGCAAGCAGAGCCTC
CTGCCGGCCTGCATATTCGTCTTTTCCAAGAAGCGATGCGAGGAGAATGCGGACGCGCTGAGCAACCAGGACTTT
TGCACGGCGTCGGAGAAGAGCCACATCCACATGATCATCGAAAGGTCGATCGCGCGGCTGAAGCCCGAGGACAGG
GTGCTACCACAGATCATCCGTCTCAAGGAGCTGCTGAACCGCGGCATCGCCGTCCATCACGGCGGCCTGCTGCCC
ATCGTCAAGGAGCTGGTGGAGATTCTGTTCGCCCAGACGCTGGTCAAGGTGCTGTTCGCCACTGAGACGTTTGCC
ATGGGCCTGAACCTGCCGACGCGGACCGTCGTCTTCTCGGGCTACCGCAAGCACGACGGCCACTCGTTCCGCAAC
CTGTTGCCCGGAGAATACACGCAGATGGCGGGCCGAGCCGGGCGACGCGGGCTCGACACTGTCGGCTCCGTCATC
ATCGTGCCTCCCGGCGGCTCCGACGACGTGCCCCCCGTAGCCGAGCTCCGCAACATGATCCTCGGCGCGCCGTCC
AAGCTGCGGTCGCAGTTCCGGCTCACGTACAACATGATTCTCAACCTGCTGAGAGTGGAGGCGCTCAAGATCGAG
GAGATGATTAAGCGCAGCTTCTCGGAACACGCCACCCAGCAGCTTCTGCCGGAGCACGAGAAGGGCGTCCGGCTG
GCGCAGGCGGACCTGGCCAAGGTCAAGCGAGACGCGTGCCAGCTGTGCGACGGCGCAGTGGACGAGTGCCACCAG
GCGGCGCAGGACTACAGGCAGTTGACGCTGGAACTCTACAAGGGCCTCTTGCGCATCGTCATCGGCCGCAAGATG
TTCTGCCCGCAGCGGCTGGTGGTCTTTAGCTGGGAGGGCATCCGCACCGCCGGGCTGCTGGTGGCCGAGGGCATG
AGTCCCAGGGGCTCTCTGGAGGAGCCCATACTGCAGGTGTGCGCGGTCCAGCCTCTCCGGCAGCAGCGCGAGGCG
GCCGACCTGCTGCCCTTTGTTCCGGCGTTCCGCCAGTATCTACACCGGCTGCCGCAGGGCAAGCGGAAGCACGAG
TCCGGCATGATACGGATGAAGATGGTACACGTGCCGCTCAGCGACGTCGAGTGTCTGACAAGGTGGGTGCTCAAG
GGCACCATCCCGGACGTCACCCGGCGCGGCGTGGTCGGACAGCAGGCTATGGAGCGGGTCAGGGAGTTTTGCGCC
TCGTGGGACAACGCCTCGGACGACAGGTGGGACGAGTTGGACCTGGGCCGAATCAAGAGCCTGCAGTTGCAAGAG
ATGGCGGAGAAGAGGGCGAGGCTGATCAAGGTCATGTCGGCGTCTTCGGCCACGAGGTGTCCCAACTTTGTGAAG
CACTTTGCCATGTGCCACGACGAATGGCTCATCAAGGAGCACATCTTGCAGCTCAAGCAGTCGCTTTCGGATCAG
AACCTGCAGCTGCTGCCCGACTACGAGCAGCGGGTGCAGGTGCTCAAGGAGCTGGGCTTCGTCGATGAGGCGACG
CGGATCCAGCTCAAGGGCAAAGTAGCTTGCGAAGTGCACTCGGGCGACGAGCTCGTCCTGACGGAGCTGATACTC
GACAACGTGCTGGCCGACTTCGAGCCAGCCGAGATTGCGGCCCTGCTGTCGTCGTTTGTCTTTCAGGAGAAGACG
CTGGTTGAGCCGGCGCTGACGAGCAACCTTGCCCGGGGTCGGGACACCATCGTCGCCATCTCGGAAAAGGTCAAC
GACGTGCAGACGCGGCTGCAGGTGATTCAGTCTTCGGACGAGTCCAACGACTTCGTATCTCGTCCCCGCTTCGGC
CTCATGGAGGTAGTGTACGAATGGGCGCGAGGCATGAGCTTCAAGAACATTACGGCGCTGACCGACGTGCTCGAG
GGCACCATTGTGCGAACGATGACGAGGCTGGATGAGACGTGTCGCGAGGTCAAGAATGCGGCGCGCATTGTTGGC
GATCCGGAGTTGTATCGGAAGATGCAGGCGGCGCAGGATATGATTAAGCGGGATATCACGGCTGTGGCTAGTCTG
TATATGTGA
Transcript >Ophcf2|02968
ATGGCTGCAATAGACGACCTACTTCTATCGCAGAAGCCTGGCGATTTCGTCCGGCGTCGGCCTCGAGATATGGTC
GAGGTGAAGCGCCGTCTCGAGACCCAGTTTCTGTTTCCTTCAGCCGCATTCTCGACCGAGTGGCTCAACCGGCTG
CAGCAGCGATGGGAATTCGAAGCCGACTATCCCTCGCTCTTCAGTATTGCCCCGCCGCTGACTCGTACTGTCACT
CGATTTCTTCGTCGGGGGCTCGAGGGCAGGGTGACGGGCTACGAAAACGTGACGGTTCCGATGAACGGCGCCACG
GCCAAGAACTCGACCAGCCTGCTACGAAAGCCCGCGGGTCGTGCCGATTTTGTGAGGGGCGCTGCTGGATTCTTC
CCCTTTGCTCCCGGAGGGCTTGAAGGTATCGAGGCCACATCGGCTCTAGAGGACCAGGTTCATGCCGGTGTCGCC
GCCGTCGAAGACTCGGGCCCACGAGCAAACAAGCTCGAGAGGGTCATCCAACTCGGCTCTCATGGAAGTTTACTT
GAGGTTGCTCCCGGCATGGATCGAGGCATCGACTTTGATAACAAGAACGACGACAGCGAAGATGCAAAGGCCATC
GAGCAGGTGTTGGCGGAAGATCCCGAAGACCAAGATTCGAAGAAGGATGACGAAGATGGTGCCCCGTCTCAGGAT
TTGCCAGAAGACGTGACTGATCGATACGAGGACGGCGACGAAATCGACGACATCTTACCCGTCGAGTTCCCCTCG
CTCGAACCCCGAGGCGTGCTCGCGGGCTCCAGCGCCAGAAAGGCTGGCCGCGAATGGGCGCACATGGTGGACATC
AAGCACGGCATGCCCAATTTCAGAGAGCTGGTGCCTGACATGGCTCGAGAGTGGCCGTTTGAGCTCGACACTTTC
CAGAAAGAAGCCGTCTATCACCTCGAAAACGGGGATTCCGTCTTCGTCGCCGCTCATACGTCGGCGGGCAAGACG
GTCGTTGCCGAGTATGCAATTGCTCTGGCGGCCAGACACATGACCAAGGCCATCTATACGTCGCCCATCAAAGCA
CTCAGCAACCAAAAGTTTCGAGATTTCCGCAACGACTTTGGCGATGTCGGCATCCTGACGGGCGACGTCCAGATC
AACCCTGAGGCCAGCTGCCTCATCATGACGACGGAGATCCTTCGAAGCATGTTGTATCGGGGAGCAGACCTGATA
CGTGATGTCGAGTTTGTCATCTTTGACGAGGTGCACTATGTCAACGACTATGAGCGAGGCGTCGTCTGGGAAGAG
GTCATCATCATGCTGCCCGAGCACGTATCTCTCATTCTCTTGTCGGCGACGGTCCCCAATACCTACGAATTTGCC
TCGTGGGTCGGCAGGACCAAGCAAAAGGACATTTACGTCATATCGACCTCGAAGCGGCCGGTGCCCCTGGAGCAC
TTCCTCTGGGCCGGCAAGAATGTCCACAGGATCGTTGATGCAGACAAGAACTTTGTGGAGAGCGGATGGAGGGAC
GCTCACAGCGCCACTCGACCCAAAGACAAGCAGAGGCCGGCAGAGACGTCGATGGCCGTCCGGGGGGGCAACGCT
CGAGGCGGCAACTCCCGGGGCGGACAGCGGGGCGGAGGCCGGGGCGCCGGCGGACCGCAGCGCGGAGGAGCCGGC
GGACAGCAAAGAGGACGCGGCGGTCCTCCTCGGGCCAGCCATGCTCCCGGTCACATGGGCAGAGGCGGCCGTGCC
GGAGGCATGACGTCGGCGGCTCAGGATAAGAATTTATGGGTTCATCTGGTGCAGTTCCTCCGCAAGCAGAGCCTC
CTGCCGGCCTGCATATTCGTCTTTTCCAAGAAGCGATGCGAGGAGAATGCGGACGCGCTGAGCAACCAGGACTTT
TGCACGGCGTCGGAGAAGAGCCACATCCACATGATCATCGAAAGGTCGATCGCGCGGCTGAAGCCCGAGGACAGG
GTGCTACCACAGATCATCCGTCTCAAGGAGCTGCTGAACCGCGGCATCGCCGTCCATCACGGCGGCCTGCTGCCC
ATCGTCAAGGAGCTGGTGGAGATTCTGTTCGCCCAGACGCTGGTCAAGGTGCTGTTCGCCACTGAGACGTTTGCC
ATGGGCCTGAACCTGCCGACGCGGACCGTCGTCTTCTCGGGCTACCGCAAGCACGACGGCCACTCGTTCCGCAAC
CTGTTGCCCGGAGAATACACGCAGATGGCGGGCCGAGCCGGGCGACGCGGGCTCGACACTGTCGGCTCCGTCATC
ATCGTGCCTCCCGGCGGCTCCGACGACGTGCCCCCCGTAGCCGAGCTCCGCAACATGATCCTCGGCGCGCCGTCC
AAGCTGCGGTCGCAGTTCCGGCTCACGTACAACATGATTCTCAACCTGCTGAGAGTGGAGGCGCTCAAGATCGAG
GAGATGATTAAGCGCAGCTTCTCGGAACACGCCACCCAGCAGCTTCTGCCGGAGCACGAGAAGGGCGTCCGGCTG
GCGCAGGCGGACCTGGCCAAGGTCAAGCGAGACGCGTGCCAGCTGTGCGACGGCGCAGTGGACGAGTGCCACCAG
GCGGCGCAGGACTACAGGCAGTTGACGCTGGAACTCTACAAGGGCCTCTTGCGCATCGTCATCGGCCGCAAGATG
TTCTGCCCGCAGCGGCTGGTGGTCTTTAGCTGGGAGGGCATCCGCACCGCCGGGCTGCTGGTGGCCGAGGGCATG
AGTCCCAGGGGCTCTCTGGAGGAGCCCATACTGCAGGTGTGCGCGGTCCAGCCTCTCCGGCAGCAGCGCGAGGCG
GCCGACCTGCTGCCCTTTGTTCCGGCGTTCCGCCAGTATCTACACCGGCTGCCGCAGGGCAAGCGGAAGCACGAG
TCCGGCATGATACGGATGAAGATGGTACACGTGCCGCTCAGCGACGTCGAGTGTCTGACAAGGTGGGTGCTCAAG
GGCACCATCCCGGACGTCACCCGGCGCGGCGTGGTCGGACAGCAGGCTATGGAGCGGGTCAGGGAGTTTTGCGCC
TCGTGGGACAACGCCTCGGACGACAGGTGGGACGAGTTGGACCTGGGCCGAATCAAGAGCCTGCAGTTGCAAGAG
ATGGCGGAGAAGAGGGCGAGGCTGATCAAGGTCATGTCGGCGTCTTCGGCCACGAGGTGTCCCAACTTTGTGAAG
CACTTTGCCATGTGCCACGACGAATGGCTCATCAAGGAGCACATCTTGCAGCTCAAGCAGTCGCTTTCGGATCAG
AACCTGCAGCTGCTGCCCGACTACGAGCAGCGGGTGCAGGTGCTCAAGGAGCTGGGCTTCGTCGATGAGGCGACG
CGGATCCAGCTCAAGGGCAAAGTAGCTTGCGAAGTGCACTCGGGCGACGAGCTCGTCCTGACGGAGCTGATACTC
GACAACGTGCTGGCCGACTTCGAGCCAGCCGAGATTGCGGCCCTGCTGTCGTCGTTTGTCTTTCAGGAGAAGACG
CTGGTTGAGCCGGCGCTGACGAGCAACCTTGCCCGGGGTCGGGACACCATCGTCGCCATCTCGGAAAAGGTCAAC
GACGTGCAGACGCGGCTGCAGGTGATTCAGTCTTCGGACGAGTCCAACGACTTCGTATCTCGTCCCCGCTTCGGC
CTCATGGAGGTAGTGTACGAATGGGCGCGAGGCATGAGCTTCAAGAACATTACGGCGCTGACCGACGTGCTCGAG
GGCACCATTGTGCGAACGATGACGAGGCTGGATGAGACGTGTCGCGAGGTCAAGAATGCGGCGCGCATTGTTGGC
GATCCGGAGTTGTATCGGAAGATGCAGGCGGCGCAGGATATGATTAAGCGGGATATCACGGCTGTGGCTAGTCTG
TATATGTGA
Gene >Ophcf2|02968
ATGGCTGCAATAGACGACCTACTTCTATCGCAGAAGCCTGGCGATTTCGTCCGGCGTCGGCCTCGAGATATGGTC
GAGGTGAAGCGCCGTCTCGAGACCCAGTTTCTGTTTCCTTCAGCCGCATTCTCGACCGAGTGGCTCAACCGGCTG
CAGCAGCGATGGGAATTCGAAGCCGACTATCCCTCGCTCTTCAGTATTGCCCCGCCGCTGACTCGTACTGTCACT
CGATTTCTTCGTCGGGGGCTCGAGGGCAGGGTGACGGGCTACGAAAACGTGACGGTTCCGATGAACGGCGCCACG
GCCAAGAACTCGACCAGCCTGCTACGAAAGCCCGCGGGTCGTGCCGATTTTGTGAGGGGCGCTGCTGGATTCTTC
CCCTTTGCTCCCGGAGGGCTTGAAGGTATCGAGGCCACATCGGCTCTAGAGGACCAGGTTCATGCCGGTGTCGCC
GCCGTCGAAGACTCGGGCCCACGAGCAAACAAGCTCGAGAGGGTCATCCAACTCGGCTCTCATGGAAGTTTACTT
GAGGTTGCTCCCGGCATGGATCGAGGCATCGACTTTGATAACAAGAACGACGACAGCGAAGATGCAAAGGCCATC
GAGCAGGTGTTGGCGGAAGATCCCGAAGACCAAGATTCGAAGAAGGATGACGAAGATGGTGCCCCGTCTCAGGAT
TTGCCAGAAGACGTGACTGATCGATACGAGGACGGCGACGAAATCGACGACATCTTACCCGTCGAGTTCCCCTCG
CTCGAACCCCGAGGCGTGCTCGCGGGCTCCAGCGCCAGAAAGGCTGGCCGCGAATGGGCGCACATGGTGGACATC
AAGCACGGCATGCCCAATTTCAGAGAGCTGGTGCCTGACATGGCTCGAGAGTGGCCGTTTGAGCTCGACACTTTC
CAGAAAGAAGCCGTCTATCACCTCGAAAACGGGGATTCCGTCTTCGTCGCCGCTCATACGTCGGCGGGCAAGACG
GTCGTTGCCGAGTATGCAATTGCTCTGGCGGCCAGACACATGACCAAGGCCATCTATACGTCGCCCATCAAAGCA
CTCAGCAACCAAAAGTTTCGAGATTTCCGCAACGACTTTGGCGATGTCGGCATCCTGACGGGCGACGTCCAGATC
AACCCTGAGGCCAGCTGCCTCATCATGACGACGGAGATCCTTCGAAGCATGTTGTATCGGGGAGCAGACCTGATA
CGTGATGTCGAGTTTGTCATCTTTGACGAGGTGCACTATGTCAACGACTATGAGCGAGGCGTCGTCTGGGAAGAG
GTCATCATCATGCTGCCCGAGCACGTATCTCTCATTCTCTTGTCGGCGACGGTCCCCAATACCTACGAATTTGCC
TCGTGGGTCGGCAGGACCAAGCAAAAGGACATTTACGTCATATCGACCTCGAAGCGGCCGGTGCCCCTGGAGCAC
TTCCTCTGGGCCGGCAAGAATGTCCACAGGATCGTTGATGCAGACAAGAACTTTGTGGAGAGCGGATGGAGGGAC
GCTCACAGCGCCACTCGACCCAAAGACAAGCAGAGGCCGGCAGAGACGTCGATGGCCGTCCGGGGGGGCAACGCT
CGAGGCGGCAACTCCCGGGGCGGACAGCGGGGCGGAGGCCGGGGCGCCGGCGGACCGCAGCGCGGAGGAGCCGGC
GGACAGCAAAGAGGACGCGGCGGTCCTCCTCGGGCCAGCCATGCTCCCGGTCACATGGGCAGAGGCGGCCGTGCC
GGAGGCATGACGTCGGCGGCTCAGGATAAGAATTTATGGGTTCATCTGGTGCAGTTCCTCCGCAAGCAGAGCCTC
CTGCCGGCCTGCATATTCGTCTTTTCCAAGAAGCGATGCGAGGAGAATGCGGACGCGCTGAGCAACCAGGACTTT
TGCACGGCGTCGGAGAAGAGCCACATCCACATGATCATCGAAAGGTCGATCGCGCGGCTGAAGCCCGAGGACAGG
GTGCTACCACAGATCATCCGTCTCAAGGAGCTGCTGAACCGCGGCATCGCCGTCCATCACGGCGGCCTGCTGCCC
ATCGTCAAGGAGCTGGTGGAGATTCTGTTCGCCCAGACGCTGGTCAAGGTGCTGTTCGCCACTGAGACGTTTGCC
ATGGGCCTGAACCTGCCGACGCGGACCGTCGTCTTCTCGGGCTACCGCAAGCACGACGGCCACTCGTTCCGCAAC
CTGTTGCCCGGAGAATACACGCAGATGGCGGGCCGAGCCGGGCGACGCGGGCTCGACACTGTCGGCTCCGTCATC
ATCGTGCCTCCCGGCGGCTCCGACGACGTGCCCCCCGTAGCCGAGCTCCGCAACATGATCCTCGGCGCGCCGTCC
AAGCTGCGGTCGCAGTTCCGGCTCACGTACAACATGATTCTCAACCTGCTGAGAGTGGAGGCGCTCAAGATCGAG
GAGATGATTAAGCGCAGCTTCTCGGAACACGCCACCCAGCAGCTTCTGCCGGAGCACGAGAAGGGCGTCCGGCTG
GCGCAGGCGGACCTGGCCAAGGTCAAGCGAGACGCGTGCCAGCTGTGCGACGGCGCAGTGGACGAGTGCCACCAG
GCGGCGCAGGACTACAGGCAGTTGACGCTGGAACTCTACAAGGGCCTCTTGCGCATCGTCATCGGCCGCAAGATG
TTCTGCCCGCAGCGGCTGGTGGTCTTTAGCTGGGAGGGCATCCGCACCGCCGGGCTGCTGGTGGCCGAGGGCATG
AGTCCCAGGGGCTCTCTGGAGGAGCCCATACTGCAGGTGTGCGCGGTCCAGCCTCTCCGGCAGCAGCGCGAGGCG
GCCGACCTGCTGCCCTTTGTTCCGGCGTTCCGCCAGTATCTACACCGGCTGCCGCAGGGCAAGCGGAAGCACGAG
TCCGGCATGATACGGATGAAGATGGTACACGTGCCGCTCAGCGACGTCGAGTGTCTGACAAGGTGGGTGCTCAAG
GGCACCATCCCGGACGTCACCCGGCGCGGCGTGGTCGGACAGCAGGCTATGGAGCGGGTCAGGGAGTTTTGCGCC
TCGTGGGACAACGCCTCGGACGACAGGTGGGACGAGTTGGACCTGGGCCGAATCAAGAGCCTGCAGTTGCAAGAG
ATGGCGGAGAAGAGGGCGAGGCTGATCAAGGTCATGTCGGCGTCTTCGGCCACGAGGTGTCCCAACTTTGTGAAG
CACGTGAGTTGTCGTTGCCTCCCCCCCCCTGAGGCTGAGCAGCAAGATGGAAGGCACAGACTGACTCTCTCTCTC
TCTCTCTCTCACAGTTTGCCATGTGCCACGACGAATGGCTCATCAAGGAGCACATCTTGCAGCTCAAGCAGTCGC
TTTCGGATCAGAACCTGCAGCTGCTGCCCGACTACGAGCAGCGGGTGCAGGTGCTCAAGGAGCTGGGCTTCGTCG
ATGAGGCGACGCGGATCCAGCTCAAGGGCAAAGTAGCTTGCGAAGTGCACTCGGGCGACGAGCTCGTCCTGACGG
AGCTGATACTCGACAACGTGCTGGCCGACTTCGAGCCAGCCGAGATTGCGGCCCTGCTGTCGTCGTTTGTCTTTC
AGGAGAAGACGCTGGTTGAGCCGGCGCTGACGAGCAACCTTGCCCGGGGTCGGGACACCATCGTCGCCATCTCGG
AAAAGGTCAACGACGTGCAGACGCGGCTGCAGGTGATTCAGTCTTCGGACGAGTCCAACGACTTCGTATCTCGTC
CCCGCTTCGGCCTCATGGAGGTAGTGTACGAATGGGCGCGAGGCATGAGCTTCAAGAACATTACGGCGCTGACCG
ACGTGCTCGAGGGCACCATTGTGCGAACGATGACGAGGCTGGATGAGACGTGTCGCGAGGTCAAGAATGCGGCGC
GCATTGTTGGCGATCCGGAGTTGTATCGGAAGATGCAGGCGGCGCAGGATATGATTAAGCGGGATATCACGGCTG
TGGCTAGTCTGTATATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail