Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02966
Gene name
Locationscaffold_03:268536..269199
Strand+
Gene length (bp)663
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6301 0.5995 0.22 0.0771 0.254 0.093 0.0674 0.2356 0.1289 0.091

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4964
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7076
Ophiocordyceps australis map64 (Brazil) OphauB2|460
Ophiocordyceps camponoti-floridani Ophcf2|02966 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6309
Ophiocordyceps subramaniannii Hirsu2|2023

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02966
MADGLAEAFDAARLEHNLAPSISVEVHRGALQFLPSSTRLDLLVSPANSYGLMDGGFDDALSRALAPVDDYPALT
RIAQARLYQEWRGFAPPGTCTLLRIPDEWEQRSDNAWGARYVAICPTMRLPQDATWDRDVVYECVWSLLCAIDRH
NRSGEPHIRSILMTPLATGVGRVSAQRWAQQLVLALNHFLDALERPELWRALTPSAVDDVASALADTWNL*
Coding >Ophcf2|02966
ATGGCAGACGGCCTAGCCGAGGCTTTTGACGCGGCACGGCTGGAACATAATCTTGCGCCGTCCATCTCAGTCGAG
GTGCATCGTGGCGCACTGCAGTTCCTCCCGTCTTCGACACGACTCGATCTGCTCGTTTCGCCGGCCAACTCGTAC
GGGCTGATGGATGGCGGCTTCGATGATGCCCTCTCCCGTGCGCTGGCTCCAGTAGACGACTACCCGGCCCTGACT
CGAATCGCTCAGGCGCGCCTCTACCAAGAATGGCGAGGCTTCGCGCCGCCAGGGACCTGCACCTTGCTGCGCATC
CCCGACGAGTGGGAGCAGCGATCCGACAACGCATGGGGCGCGCGATACGTGGCCATCTGCCCGACAATGCGACTT
CCTCAGGATGCGACCTGGGATCGAGACGTGGTCTATGAGTGCGTCTGGAGTCTGCTTTGCGCCATCGACCGCCAC
AATCGCAGCGGCGAGCCGCACATCCGCAGCATCCTCATGACGCCGCTGGCAACTGGCGTGGGCCGAGTGAGTGCC
CAACGATGGGCTCAGCAGCTGGTCCTCGCACTAAATCACTTCCTCGATGCCCTTGAGAGGCCTGAACTGTGGAGA
GCCTTGACGCCGTCGGCGGTAGATGACGTTGCGAGTGCCCTGGCAGACACGTGGAACTTGTAG
Transcript >Ophcf2|02966
ATGGCAGACGGCCTAGCCGAGGCTTTTGACGCGGCACGGCTGGAACATAATCTTGCGCCGTCCATCTCAGTCGAG
GTGCATCGTGGCGCACTGCAGTTCCTCCCGTCTTCGACACGACTCGATCTGCTCGTTTCGCCGGCCAACTCGTAC
GGGCTGATGGATGGCGGCTTCGATGATGCCCTCTCCCGTGCGCTGGCTCCAGTAGACGACTACCCGGCCCTGACT
CGAATCGCTCAGGCGCGCCTCTACCAAGAATGGCGAGGCTTCGCGCCGCCAGGGACCTGCACCTTGCTGCGCATC
CCCGACGAGTGGGAGCAGCGATCCGACAACGCATGGGGCGCGCGATACGTGGCCATCTGCCCGACAATGCGACTT
CCTCAGGATGCGACCTGGGATCGAGACGTGGTCTATGAGTGCGTCTGGAGTCTGCTTTGCGCCATCGACCGCCAC
AATCGCAGCGGCGAGCCGCACATCCGCAGCATCCTCATGACGCCGCTGGCAACTGGCGTGGGCCGAGTGAGTGCC
CAACGATGGGCTCAGCAGCTGGTCCTCGCACTAAATCACTTCCTCGATGCCCTTGAGAGGCCTGAACTGTGGAGA
GCCTTGACGCCGTCGGCGGTAGATGACGTTGCGAGTGCCCTGGCAGACACGTGGAACTTGTAG
Gene >Ophcf2|02966
ATGGCAGACGGCCTAGCCGAGGCTTTTGACGCGGCACGGCTGGAACATAATCTTGCGCCGTCCATCTCAGTCGAG
GTGCATCGTGGCGCACTGCAGTTCCTCCCGTCTTCGACACGACTCGATCTGCTCGTTTCGCCGGCCAACTCGTAC
GGGCTGATGGATGGCGGCTTCGATGATGCCCTCTCCCGTGCGCTGGCTCCAGTAGACGACTACCCGGCCCTGACT
CGAATCGCTCAGGCGCGCCTCTACCAAGAATGGCGAGGCTTCGCGCCGCCAGGGACCTGCACCTTGCTGCGCATC
CCCGACGAGTGGGAGCAGCGATCCGACAACGCATGGGGCGCGCGATACGTGGCCATCTGCCCGACAATGCGACTT
CCTCAGGATGCGACCTGGGATCGAGACGTGGTCTATGAGTGCGTCTGGAGTCTGCTTTGCGCCATCGACCGCCAC
AATCGCAGCGGCGAGCCGCACATCCGCAGCATCCTCATGACGCCGCTGGCAACTGGCGTGGGCCGAGTGAGTGCC
CAACGATGGGCTCAGCAGCTGGTCCTCGCACTAAATCACTTCCTCGATGCCCTTGAGAGGCCTGAACTGTGGAGA
GCCTTGACGCCGTCGGCGGTAGATGACGTTGCGAGTGCCCTGGCAGACACGTGGAACTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail