Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02959
Gene name
Locationscaffold_03:195968..197283
Strand+
Gene length (bp)1315
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08498 Sterol_MT_C Sterol methyltransferase C-terminal 2.6E-30 314 378
PF08241 Methyltransf_11 Methyltransferase domain 2.5E-20 134 230
PF13649 Methyltransf_25 Methyltransferase domain 1.3E-19 133 228
PF13847 Methyltransf_31 Methyltransferase domain 1.7E-17 129 232
PF13489 Methyltransf_23 Methyltransferase domain 6.7E-12 128 282
PF08242 Methyltransf_12 Methyltransferase domain 1.8E-10 134 230
PF02353 CMAS Mycolic acid cyclopropane synthetase 1.2E-10 79 255
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.4E-10 120 234
PF07021 MetW Methionine biosynthesis protein MetW 6.7E-05 127 203

GO

GO Term Description Terminal node
GO:0006694 steroid biosynthetic process Yes
GO:0008168 methyltransferase activity Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016740 transferase activity No
GO:0006629 lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008202 steroid metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008610 lipid biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.4195 0.1121 0.0672 0.1958 0.2415 0.0523 0.7056 0.1807 0.2708 0.0268

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup762
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3684
Ophiocordyceps australis map64 (Brazil) OphauB2|3978
Ophiocordyceps camponoti-floridani Ophcf2|02959 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6301
Ophiocordyceps kimflemingae Ophio5|6915
Ophiocordyceps kimflemingae Ophio5|7799
Ophiocordyceps subramaniannii Hirsu2|2555

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02959
MPSSKSDLEREDHGRDAAFNKAMHGNSAQARGGIAAMFSKGADAKKAAVDEYFKHWDNKTAADETPEQRAARTAE
YATLTRHYYNLATDLYEYGWGQSFHFCRFSKGEPFYQAIARHEHYLAHSMGIQEGSRVLDVGCGVGGPAREIAKF
TGAHITGLNNNDYQIQRATHYAAQEGLAGQVNFVKGDFMHMSFPDNSFDAVYAIEATVHAPTLEGIYSQIFRVLK
PGGVFGVYEWLMTDAYDNDKLHHREIRLGIEQGDGISNMCKVSEALDAIKAAGFELVRNEDLADRPDPLPWYWPL
SGDMRYIQSIGDIFTIARMTRWGRAMAHNLAGLLETIRLAPAGTKKTADSLAVAADCLVAGGRERLFTPMYLMVA
RKPIQ*
Coding >Ophcf2|02959
ATGCCCTCTTCCAAGTCGGACCTCGAGCGTGAAGACCACGGCCGCGATGCCGCCTTCAACAAGGCCATGCACGGC
AATTCGGCGCAGGCTCGTGGCGGCATAGCGGCCATGTTTTCCAAGGGTGCCGATGCGAAGAAGGCAGCCGTCGAC
GAGTACTTTAAGCACTGGGACAACAAGACTGCTGCCGACGAGACGCCTGAGCAGCGCGCTGCGAGGACGGCTGAG
TATGCGACCCTTACAAGGCACTACTACAACCTCGCGACGGACCTGTACGAGTATGGCTGGGGCCAGTCGTTCCAC
TTTTGCCGCTTCTCCAAGGGCGAACCCTTTTACCAGGCCATTGCCCGCCACGAACACTACCTGGCCCACAGCATG
GGCATTCAGGAGGGCAGTCGCGTGCTCGACGTCGGGTGCGGCGTCGGTGGGCCGGCCCGTGAGATTGCCAAGTTC
ACGGGCGCACACATCACGGGCCTGAACAACAACGACTACCAGATTCAACGTGCCACACACTATGCCGCTCAAGAG
GGGTTGGCCGGCCAGGTCAACTTTGTGAAGGGTGATTTTATGCATATGTCGTTCCCGGACAACAGTTTCGACGCC
GTCTACGCTATTGAAGCGACAGTGCACGCGCCGACGCTTGAAGGCATCTACAGCCAGATCTTCCGCGTTCTGAAA
CCGGGCGGAGTCTTCGGCGTCTACGAGTGGCTCATGACGGACGCATACGATAATGACAAGCTCCATCACCGCGAG
ATCCGGCTCGGCATCGAGCAAGGCGACGGCATATCCAACATGTGCAAGGTTTCAGAGGCTCTAGACGCAATCAAG
GCCGCTGGCTTCGAGCTCGTGCGCAACGAGGATCTTGCCGACCGTCCTGACCCCTTGCCCTGGTACTGGCCTCTA
TCGGGAGACATGCGCTACATACAGTCTATTGGCGACATCTTTACCATTGCTCGCATGACTCGATGGGGTCGCGCC
ATGGCTCACAACTTGGCTGGCCTGCTCGAGACGATAAGACTGGCTCCGGCGGGGACGAAGAAGACGGCCGATAGC
TTGGCGGTTGCTGCTGACTGCCTCGTTGCTGGCGGGCGTGAGCGTCTGTTTACGCCCATGTATCTGATGGTTGCT
CGCAAGCCGATTCAATGA
Transcript >Ophcf2|02959
ATGCCCTCTTCCAAGTCGGACCTCGAGCGTGAAGACCACGGCCGCGATGCCGCCTTCAACAAGGCCATGCACGGC
AATTCGGCGCAGGCTCGTGGCGGCATAGCGGCCATGTTTTCCAAGGGTGCCGATGCGAAGAAGGCAGCCGTCGAC
GAGTACTTTAAGCACTGGGACAACAAGACTGCTGCCGACGAGACGCCTGAGCAGCGCGCTGCGAGGACGGCTGAG
TATGCGACCCTTACAAGGCACTACTACAACCTCGCGACGGACCTGTACGAGTATGGCTGGGGCCAGTCGTTCCAC
TTTTGCCGCTTCTCCAAGGGCGAACCCTTTTACCAGGCCATTGCCCGCCACGAACACTACCTGGCCCACAGCATG
GGCATTCAGGAGGGCAGTCGCGTGCTCGACGTCGGGTGCGGCGTCGGTGGGCCGGCCCGTGAGATTGCCAAGTTC
ACGGGCGCACACATCACGGGCCTGAACAACAACGACTACCAGATTCAACGTGCCACACACTATGCCGCTCAAGAG
GGGTTGGCCGGCCAGGTCAACTTTGTGAAGGGTGATTTTATGCATATGTCGTTCCCGGACAACAGTTTCGACGCC
GTCTACGCTATTGAAGCGACAGTGCACGCGCCGACGCTTGAAGGCATCTACAGCCAGATCTTCCGCGTTCTGAAA
CCGGGCGGAGTCTTCGGCGTCTACGAGTGGCTCATGACGGACGCATACGATAATGACAAGCTCCATCACCGCGAG
ATCCGGCTCGGCATCGAGCAAGGCGACGGCATATCCAACATGTGCAAGGTTTCAGAGGCTCTAGACGCAATCAAG
GCCGCTGGCTTCGAGCTCGTGCGCAACGAGGATCTTGCCGACCGTCCTGACCCCTTGCCCTGGTACTGGCCTCTA
TCGGGAGACATGCGCTACATACAGTCTATTGGCGACATCTTTACCATTGCTCGCATGACTCGATGGGGTCGCGCC
ATGGCTCACAACTTGGCTGGCCTGCTCGAGACGATAAGACTGGCTCCGGCGGGGACGAAGAAGACGGCCGATAGC
TTGGCGGTTGCTGCTGACTGCCTCGTTGCTGGCGGGCGTGAGCGTCTGTTTACGCCCATGTATCTGATGGTTGCT
CGCAAGCCGATTCAATGA
Gene >Ophcf2|02959
ATGCCCTCTTCCAAGTCGGACCTCGAGCGTGAAGACCACGGCCGCGATGCCGCCTTCAACAAGGCCATGCACGGC
AATTCGGCGCAGGCTCGTGGCGGCATAGCGGCCATGTTTTCCAAGGGTGCCGATGCGAAGAAGGCAGCCGTCGAC
GAGTACTTTAAGCACTGGGACAACAAGACTGCTGCCGACGAGACGCCTGAGCAGCGCGCTGTGAGTCTGGGTCAG
GTGTGACGGTCTCGATATGGAGTGACTGACGACGTACCAGGCGAGGACGGCTGAGTATGCGACCCTTACAAGGCA
GTGAGTACATGCTTCAAGGCTCTAATCTCTCGAAACCGTCCATCTGACGCCAATCTCAGCTACTACAACCTCGCG
ACGGACCTGTACGAGTATGGCTGGGGCCAGTCGTTCCACTTTTGCCGCTTCTCCAAGGGCGAACCCTTTTACCAG
GCCATTGCCCGCCACGAACACTACCTGGCCCACAGCATGGGCATTCAGGAGGGCAGTCGCGTGCTCGACGTCGGG
TGCGGCGTCGGTGGGCCGGCCCGTGAGATTGCCAAGTTCACGGGCGCACACATCACGGGCCTGAACAACAACGAC
TACCAGATTCAACGTGCCACACACTATGCCGCTCAAGAGGGGTTGGCCGGCCAGGTCAACTTTGTGAAGGGTGAT
TTTATGGTGAGCAGGGAGAAGGCTGGCTTGGACGACACGAGCCGCGATGCTGATGGGGGGGTAGCATATGTCGTT
CCCGGACAACAGTTTCGACGCCGTCTACGCTATTGAAGCGACAGTGCACGCGCCGACGCTTGAAGGCATCTACAG
CCAGATCTTCCGCGTTCTGAAACCGGGCGGAGTCTTCGGCGTCTACGAGTGGCTCATGACGGACGCATACGATAA
TGACAAGCTCCATCACCGCGAGATCCGGCTCGGCATCGAGCAAGGCGACGGCATATCCAACATGTGCAAGGTTTC
AGAGGCTCTAGACGCAATCAAGGCCGCTGGCTTCGAGCTCGTGCGCAACGAGGATCTTGCCGACCGTCCTGACCC
CTTGCCCTGGTACTGGCCTCTATCGGGAGACATGCGCTACATACAGTCTATTGGCGACATCTTTACCATTGCTCG
CATGACTCGATGGGGTCGCGCCATGGCTCACAACTTGGCTGGCCTGCTCGAGACGATAAGACTGGCTCCGGCGGG
GACGAAGAAGACGGCCGATAGCTTGGCGGTTGCTGCTGACTGCCTCGTTGCTGGCGGGCGTGAGCGTCTGTTTAC
GCCCATGTATCTGATGGTTGCTCGCAAGCCGATTCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail