Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02954
Gene name
Locationscaffold_03:183948..186449
Strand-
Gene length (bp)2501
Transcript length (bp)2094
Coding sequence length (bp)2094
Protein length (aa) 698

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 5.0E-13 307 417
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.5E-07 22 52

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043169 cation binding No
GO:0097159 organic cyclic compound binding No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0043170 macromolecule metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003700 DNA-binding transcription factor activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0019222 regulation of metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0010468 regulation of gene expression No
GO:0019438 aromatic compound biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0065007 biological regulation No
GO:0097659 nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.3604 0.7125 0.0273 0.1453 0.0333 0.0044 0.0384 0.2954 0.1918 0.025

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 550 572 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup221
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4131
Ophiocordyceps australis 1348a (Ghana) OphauG2|5633
Ophiocordyceps australis map64 (Brazil) OphauB2|2062
Ophiocordyceps australis map64 (Brazil) OphauB2|6645
Ophiocordyceps camponoti-floridani Ophcf2|02954 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03743
Ophiocordyceps camponoti-rufipedis Ophun1|520
Ophiocordyceps camponoti-rufipedis Ophun1|6296
Ophiocordyceps kimflemingae Ophio5|392
Ophiocordyceps kimflemingae Ophio5|7225
Ophiocordyceps subramaniannii Hirsu2|2549
Ophiocordyceps subramaniannii Hirsu2|7962

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02954
MQSEAINTPDLTTDEAAAAGRRACDQCRLRKIRCDREWPCSNCRIAKRTCSSTGAGQRPKEPRQRVLISSRYEGK
IDKIEARLGNIESILRSLTSTIAQDHAQLRPSTSFTPVTASGVPPTVSSTADHDVSSDESALDADDGLTAQTTFA
SEFVETAVGRGPLPQTNPSMEAALGNLRHLVQLQKRRSAGSGPRFPLQRSLPVGGLCKLAMPPMPAVVALLKQTK
NAPPSIFSIVSTLVGIDDFVGLCRIVYFATDDFSDATFTIVNGMLYNLFLEHHALATDAVIRDEYHAYMQQCRVN
LETCLANTPLFLSAKAETIQALLLGIIYAIDVSLPSVAWNLTCTAAQLCQVAGYHRAETRKLDSPATSKLKDVLF
WHIYSLDKSLSLRLGRAPVINDCDIDISLISAFDTNDPLTTNAILALWVKFGRLQSRVYEQLYSPVALTRPRAEL
TERAEALARDCRSLEAESKECHEPLYSYLQNANTSELVATFMRGDEVQLQVTCTLVYQVIPAAPGSQSRFCDECL
EAARKAIRTHMKCTLRDLGSYFRSIYIHWNLLLTPFAPFFVLFCYVIETSSTEDLNLLRELVASLSESRGLSESV
AKLYRLMQVMVDIAGLYVEAKEQQLQDQTMVPIGDEFEMYLSQLGFMPTEEHAMSNNTPGDDKGQTTQIADWFSG
NRNMMGLLEEDLSQIDAYKWMQ*
Coding >Ophcf2|02954
ATGCAGAGCGAGGCTATCAACACGCCTGATTTGACGACCGATGAGGCGGCGGCGGCGGGTCGGAGAGCCTGTGAT
CAGTGTCGGTTGCGCAAGATTCGCTGTGATCGCGAATGGCCTTGTTCGAACTGCCGCATCGCCAAACGTACCTGT
TCCTCTACCGGCGCAGGTCAACGCCCCAAAGAACCCCGTCAGCGCGTCCTCATCTCCTCACGATACGAGGGTAAA
ATAGATAAGATCGAAGCCCGACTGGGAAACATCGAATCCATCCTCCGCTCCCTAACATCCACAATCGCCCAAGAC
CATGCCCAGTTACGCCCCTCAACTTCCTTCACGCCCGTCACCGCCAGCGGCGTCCCCCCAACCGTCTCCTCCACC
GCCGACCACGACGTCAGCTCAGATGAGTCGGCGCTGGATGCGGATGATGGCCTGACGGCGCAGACGACCTTTGCC
AGCGAGTTCGTCGAAACGGCCGTTGGCCGTGGCCCGCTCCCCCAGACGAATCCCAGCATGGAGGCCGCGCTCGGG
AACCTCCGGCACCTCGTCCAGCTGCAGAAGCGTCGCTCTGCCGGTAGTGGACCGAGGTTTCCGTTGCAGAGGTCT
CTTCCGGTAGGGGGTTTGTGCAAGTTGGCGATGCCGCCTATGCCGGCTGTCGTTGCGCTGCTGAAGCAGACAAAG
AACGCTCCTCCCTCCATCTTCTCCATCGTCAGCACCCTCGTCGGCATCGATGACTTTGTCGGCTTGTGTCGCATC
GTTTACTTTGCCACCGATGACTTCTCCGACGCTACCTTTACTATTGTCAATGGCATGCTGTACAACCTGTTTCTT
GAGCATCATGCTTTGGCCACCGACGCCGTCATCCGCGACGAGTATCACGCTTACATGCAGCAATGCCGCGTCAAT
CTGGAGACTTGCCTCGCCAACACGCCTCTCTTCCTCTCGGCCAAGGCGGAAACGATTCAGGCATTGCTTCTTGGG
ATCATCTACGCCATCGACGTCTCCCTACCCTCCGTAGCTTGGAACCTCACCTGCACAGCCGCCCAACTCTGCCAA
GTAGCAGGCTATCACCGCGCCGAGACGCGCAAGCTTGACTCCCCAGCCACCTCTAAGCTCAAGGATGTCCTCTTC
TGGCACATCTACTCGCTCGACAAGAGCCTTAGCCTTCGACTAGGCAGGGCCCCCGTCATCAATGACTGCGACATC
GACATCTCGCTCATCTCGGCTTTTGACACAAATGATCCACTGACTACCAATGCCATCTTGGCTCTATGGGTCAAG
TTCGGTCGGCTTCAGAGTCGAGTCTACGAGCAGCTATACAGTCCTGTTGCGTTGACTCGTCCGCGGGCTGAGCTG
ACGGAACGTGCCGAGGCCCTGGCTCGGGATTGTAGGAGCCTCGAGGCCGAGTCGAAAGAGTGTCACGAACCTCTC
TACAGCTATCTCCAGAACGCCAACACGTCTGAACTGGTCGCCACCTTCATGCGCGGCGACGAGGTGCAGTTGCAG
GTTACCTGCACCCTCGTCTACCAGGTCATTCCCGCTGCTCCAGGCTCCCAAAGTCGCTTCTGCGACGAGTGTCTC
GAGGCCGCTCGCAAGGCCATCCGCACCCATATGAAGTGCACCCTCAGAGATCTTGGCAGTTACTTTCGCTCCATA
TACATCCACTGGAACCTGCTTTTGACCCCCTTTGCTCCCTTTTTCGTCCTCTTCTGCTACGTCATAGAGACGTCG
TCCACGGAAGATCTCAATCTTCTCCGGGAACTCGTCGCCTCCCTATCCGAGTCGCGCGGATTATCCGAGTCGGTC
GCTAAGCTCTATCGGTTGATGCAGGTCATGGTCGACATTGCTGGCTTGTATGTCGAGGCCAAGGAGCAGCAGCTC
CAGGACCAGACCATGGTGCCCATAGGCGACGAGTTCGAGATGTATCTGAGTCAACTCGGTTTCATGCCCACCGAG
GAACACGCCATGTCCAACAACACGCCCGGCGACGACAAGGGGCAGACGACGCAGATTGCAGACTGGTTCTCGGGG
AACCGTAACATGATGGGTCTGCTGGAAGAGGACTTGTCCCAGATAGACGCCTATAAGTGGATGCAATGA
Transcript >Ophcf2|02954
ATGCAGAGCGAGGCTATCAACACGCCTGATTTGACGACCGATGAGGCGGCGGCGGCGGGTCGGAGAGCCTGTGAT
CAGTGTCGGTTGCGCAAGATTCGCTGTGATCGCGAATGGCCTTGTTCGAACTGCCGCATCGCCAAACGTACCTGT
TCCTCTACCGGCGCAGGTCAACGCCCCAAAGAACCCCGTCAGCGCGTCCTCATCTCCTCACGATACGAGGGTAAA
ATAGATAAGATCGAAGCCCGACTGGGAAACATCGAATCCATCCTCCGCTCCCTAACATCCACAATCGCCCAAGAC
CATGCCCAGTTACGCCCCTCAACTTCCTTCACGCCCGTCACCGCCAGCGGCGTCCCCCCAACCGTCTCCTCCACC
GCCGACCACGACGTCAGCTCAGATGAGTCGGCGCTGGATGCGGATGATGGCCTGACGGCGCAGACGACCTTTGCC
AGCGAGTTCGTCGAAACGGCCGTTGGCCGTGGCCCGCTCCCCCAGACGAATCCCAGCATGGAGGCCGCGCTCGGG
AACCTCCGGCACCTCGTCCAGCTGCAGAAGCGTCGCTCTGCCGGTAGTGGACCGAGGTTTCCGTTGCAGAGGTCT
CTTCCGGTAGGGGGTTTGTGCAAGTTGGCGATGCCGCCTATGCCGGCTGTCGTTGCGCTGCTGAAGCAGACAAAG
AACGCTCCTCCCTCCATCTTCTCCATCGTCAGCACCCTCGTCGGCATCGATGACTTTGTCGGCTTGTGTCGCATC
GTTTACTTTGCCACCGATGACTTCTCCGACGCTACCTTTACTATTGTCAATGGCATGCTGTACAACCTGTTTCTT
GAGCATCATGCTTTGGCCACCGACGCCGTCATCCGCGACGAGTATCACGCTTACATGCAGCAATGCCGCGTCAAT
CTGGAGACTTGCCTCGCCAACACGCCTCTCTTCCTCTCGGCCAAGGCGGAAACGATTCAGGCATTGCTTCTTGGG
ATCATCTACGCCATCGACGTCTCCCTACCCTCCGTAGCTTGGAACCTCACCTGCACAGCCGCCCAACTCTGCCAA
GTAGCAGGCTATCACCGCGCCGAGACGCGCAAGCTTGACTCCCCAGCCACCTCTAAGCTCAAGGATGTCCTCTTC
TGGCACATCTACTCGCTCGACAAGAGCCTTAGCCTTCGACTAGGCAGGGCCCCCGTCATCAATGACTGCGACATC
GACATCTCGCTCATCTCGGCTTTTGACACAAATGATCCACTGACTACCAATGCCATCTTGGCTCTATGGGTCAAG
TTCGGTCGGCTTCAGAGTCGAGTCTACGAGCAGCTATACAGTCCTGTTGCGTTGACTCGTCCGCGGGCTGAGCTG
ACGGAACGTGCCGAGGCCCTGGCTCGGGATTGTAGGAGCCTCGAGGCCGAGTCGAAAGAGTGTCACGAACCTCTC
TACAGCTATCTCCAGAACGCCAACACGTCTGAACTGGTCGCCACCTTCATGCGCGGCGACGAGGTGCAGTTGCAG
GTTACCTGCACCCTCGTCTACCAGGTCATTCCCGCTGCTCCAGGCTCCCAAAGTCGCTTCTGCGACGAGTGTCTC
GAGGCCGCTCGCAAGGCCATCCGCACCCATATGAAGTGCACCCTCAGAGATCTTGGCAGTTACTTTCGCTCCATA
TACATCCACTGGAACCTGCTTTTGACCCCCTTTGCTCCCTTTTTCGTCCTCTTCTGCTACGTCATAGAGACGTCG
TCCACGGAAGATCTCAATCTTCTCCGGGAACTCGTCGCCTCCCTATCCGAGTCGCGCGGATTATCCGAGTCGGTC
GCTAAGCTCTATCGGTTGATGCAGGTCATGGTCGACATTGCTGGCTTGTATGTCGAGGCCAAGGAGCAGCAGCTC
CAGGACCAGACCATGGTGCCCATAGGCGACGAGTTCGAGATGTATCTGAGTCAACTCGGTTTCATGCCCACCGAG
GAACACGCCATGTCCAACAACACGCCCGGCGACGACAAGGGGCAGACGACGCAGATTGCAGACTGGTTCTCGGGG
AACCGTAACATGATGGGTCTGCTGGAAGAGGACTTGTCCCAGATAGACGCCTATAAGTGGATGCAATGA
Gene >Ophcf2|02954
ATGCAGAGCGAGGCTATCAACACGCCTGATTTGACGACCGATGAGGCGGCGGCGGCGGGTCGGAGAGCCGTGAGT
TGACTTGGGAGTTCGTTTGATGGTTGGTTGGTTTGCTTACTGATTGTTAACATAGTGTGATCAGTGTCGGTTGCG
CAAGGTTAGTGGTGAGTTCTGTCTCGTTAATTTCATCGTCGTCTGACTCTATAGATTCGCTGTGATCGCGAATGG
CCTTGTTCGAACTGCCGCATCGCCAAACGTACCTGTTCCTCTACCGGCGCAGGTCAACGCCCCAAAGAACCCCGT
CAGCGCGTCCTCATCTCCTCACGATAGTTCGTCATGACAGCCTCTCCTCTACGGACCTACCTTGATGGTTAACCC
ATGACAGCGAGGGTAAAATAGATAAGATCGAAGCCCGACTGGGAAACATCGAATCCATCCTCCGCTCCCTAACAT
CCACAATCGCCCAAGACCATGCCCAGTTACGCCCCTCAACTTCCTTCACGCCCGTCACCGCCAGCGGCGTCCCCC
CAACCGTCTCCTCCACCGCCGACCACGACGTCAGCTCAGATGAGTCGGCGCTGGATGCGGATGATGGCCTGACGG
CGCAGACGACCTTTGCCAGCGAGTTCGTCGAAACGGCCGTTGGCCGTGGCCCGCTCCCCCAGACGAATCCCAGCA
TGGAGGCCGCGCTCGGGAACCTCCGGCACCTCGTCCAGCTGCAGAAGCGTCGCTCTGCCGGTAGTGGACCGAGGT
TTCCGTTGCAGAGGTCTCTTCCGGTAGGGGGTTTGTGCAAGTTGGCGATGCCGCCTATGCCGGCTGTCGTTGCGC
TGCTGAAGCAGACAAAGAGTAAATTGAAGCTGTGTCCGAGTCCTATATAGACGGCTGACGAGGCCGTGGTAGACG
CTCCTCCCTCCATCTTCTCCATCGTCAGCACCCTCGTCGGCATCGATGACTTTGTCGGCTTGTGTCGCATCGTTT
ACTTTGCCACCGATGACTTCTCCGACGCTACCTTTACTATTGTCAATGGCATGCTGTACAACCTGTTTCTTGAGC
ATCATGCTTTGGCCACCGACGCCGTCATCCGCGACGAGTATCACGCTTACATGCAGCAATGCCGCGTCAATCTGG
AGACTTGCCTCGCCAACACGCCTCTCTTCCTCTCGGCCAAGGCGGAAACGATTCAGGCATTGCTTCTTGGGGTAC
GCTCCCAACATCTTGTCTACTCTCTACAACTTCCTCGTCACGTCATACAACGATAAACTGCTAAGTCGTCTAGAT
CATCTACGCCATCGACGTCTCCCTACCCTCCGTAGCTTGGAACCTCACCTGCACAGCCGCCCAACTCTGCCAAGT
AGCAGGCTATCACCGCGCCGAGACGCGCAAGCTTGACTCCCCAGCCACCTCTAAGCTCAAGGATGTCCTCTTCTG
GCACATCTACTCGCTCGACAAGAGCCTTAGCCTTCGACTAGGCAGGGCCCCCGTCATCAATGACTGCGACATCGA
CATCTCGCTCATCTCGGCTTTTGACACAAATGATCCACTGACTACCAATGCCATCTTGGCTCTATGGGTCAAGTT
CGGTCGGCTTCAGAGTCGAGTCTACGAGCAGCTGTGAGTTTGATCCCCTTTCATGGGACTTATGTCGTGTTGACT
TCGGCTGACATGGCGTCGCAGATACAGTCCTGTTGCGTTGACTCGTCCGCGGGCTGAGCTGACGGAACGTGCCGA
GGCCCTGGCTCGGGATTGTAGGAGCCTCGAGGCCGAGTCGAAAGAGTGTCACGAACCTCTCTACAGCTATCTCCA
GAACGCCAACACGTCTGAACTGGTCGCCACCTTCATGCGCGGCGACGAGGTGCAGTTGCAGGTTACCTGCACCCT
CGTCTACCAGGTCATTCCCGCTGCTCCAGGCTCCCAAAGTCGCTTCTGCGACGAGTGTCTCGAGGCCGCTCGCAA
GGCCATCCGCACCCATATGAAGTGCACCCTCAGAGATCTTGGCAGTTACTTTCGCTCCATATACATCCACTGGTG
AGCCCACAGCCGCCCAGTTCTGTCCGTCGCTTACTCCAAACAGGAACCTGCTTTTGACCCCCTTTGCTCCCTTTT
TCGTCCTCTTCTGCTACGTCATAGAGACGTCGTCCACGGAAGATCTCAATCTTCTCCGGGAACTCGTCGCCTCCC
TATCCGAGTCGCGCGGATTATCCGAGTCGGTCGCTAAGCTCTATCGGTTGATGCAGGTCATGGTCGACATTGCTG
GCTTGTATGTCGAGGCCAAGGAGCAGCAGCTCCAGGACCAGACCATGGTGCCCATAGGCGACGAGTTCGAGATGT
ATCTGAGTCAACTCGGTTTCATGCCCACCGAGGAACACGCCATGTCCAACAACACGCCCGGCGACGACAAGGGGC
AGACGACGCAGATTGCAGACTGGTTCTCGGGGAACCGTAACATGATGGGTCTGCTGGAAGAGGACTTGTCCCAGA
TAGACGCCTATAAGTGGATGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail