Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02953
Gene name
Locationscaffold_03:183233..183798
Strand+
Gene length (bp)565
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 3.6E-06 23 49

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3872 0.6664 0.0232 0.0248 0.2614 0.0125 0.0576 0.0185 0.0398 0.0027

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2130
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5632
Ophiocordyceps australis map64 (Brazil) OphauB2|2061
Ophiocordyceps camponoti-floridani Ophcf2|02953 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6295
Ophiocordyceps kimflemingae Ophio5|7226
Ophiocordyceps subramaniannii Hirsu2|2548

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02953
MPPRHQTLPPPQTTSARDAQRSFYCDLCSKGYSRMNEFEAHLSSYDHTHKKRLKDMKAMVRDPNAGARARKAEAK
ADGLVSITFDEKEASSAAASAGSGWKPGFKRSGFKSAFGPKETAQPTEAAVKLEAAPPFKKPSKQAGGDDNESDT
GDEGYERYDPRYPTD*
Coding >Ophcf2|02953
ATGCCTCCTCGACACCAGACTCTGCCCCCGCCGCAGACGACGTCGGCACGCGACGCCCAAAGGTCGTTCTACTGC
GATCTTTGCTCCAAGGGGTACTCTCGCATGAACGAGTTCGAAGCACATCTTAGCAGCTATGATCACACTCATAAG
AAGCGACTCAAGGACATGAAGGCCATGGTCCGCGATCCCAACGCCGGCGCCCGAGCCCGGAAGGCAGAGGCCAAG
GCGGATGGCCTCGTCAGCATCACCTTTGATGAGAAGGAGGCCTCGAGCGCCGCAGCTTCTGCTGGTTCGGGATGG
AAACCTGGGTTCAAGCGCAGCGGATTCAAGAGCGCTTTCGGACCCAAGGAGACTGCGCAACCGACCGAGGCGGCC
GTCAAGCTGGAAGCTGCTCCTCCCTTCAAGAAGCCGTCGAAGCAGGCAGGAGGAGATGATAACGAGAGCGACACC
GGGGACGAGGGCTACGAACGCTACGATCCGCGATATCCCACCGATTGA
Transcript >Ophcf2|02953
ATGCCTCCTCGACACCAGACTCTGCCCCCGCCGCAGACGACGTCGGCACGCGACGCCCAAAGGTCGTTCTACTGC
GATCTTTGCTCCAAGGGGTACTCTCGCATGAACGAGTTCGAAGCACATCTTAGCAGCTATGATCACACTCATAAG
AAGCGACTCAAGGACATGAAGGCCATGGTCCGCGATCCCAACGCCGGCGCCCGAGCCCGGAAGGCAGAGGCCAAG
GCGGATGGCCTCGTCAGCATCACCTTTGATGAGAAGGAGGCCTCGAGCGCCGCAGCTTCTGCTGGTTCGGGATGG
AAACCTGGGTTCAAGCGCAGCGGATTCAAGAGCGCTTTCGGACCCAAGGAGACTGCGCAACCGACCGAGGCGGCC
GTCAAGCTGGAAGCTGCTCCTCCCTTCAAGAAGCCGTCGAAGCAGGCAGGAGGAGATGATAACGAGAGCGACACC
GGGGACGAGGGCTACGAACGCTACGATCCGCGATATCCCACCGATTGA
Gene >Ophcf2|02953
ATGCCTCCTGTGAGTTGAGCTTGACCTCCATTTATCATCGTCAACCTAAAGCCCTCGCTAACAACCCATTCTATA
GCGACACCAGACTCTGCCCCCGCCGCAGACGACGTCGGCACGCGACGCCCAAAGGTCGTTCTACTGCGATCTTTG
CTCCAAGGGGTACTCTCGCATGAACGAGTTCGAAGCACATCTTAGCAGCTATGATCACACTCATAAGAAGCGACT
CAAGGACATGAAGGCCATGGTCCGCGATCCCAACGCCGGCGCCCGAGCCCGGAAGGCAGAGGCCAAGGCGGATGG
CCTCGTCAGCATCACCTTTGATGAGAAGGAGGCCTCGAGCGCCGCAGCTTCTGCTGGTTCGGGATGGAAACCTGG
GTTCAAGCGCAGCGGATTCAAGAGCGCTTTCGGACCCAAGGAGACTGCGCAACCGACCGAGGCGGCCGTCAAGCT
GGAAGCTGCTCCTCCCTTCAAGAAGCCGTCGAAGCAGGCAGGAGGAGATGATAACGAGAGCGACACCGGGGACGA
GGGCTACGAACGCTACGATCCGCGATATCCCACCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail