Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02952
Gene name
Locationscaffold_03:182004..183006
Strand-
Gene length (bp)1002
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07950 MCP1_TM MDM10-complementing protein 1, transmembrane domain 1.8E-04 84 150
PF07950 MCP1_TM MDM10-complementing protein 1, transmembrane domain 1.5E-29 193 292

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 76 98 22
2 118 140 22
3 174 196 22
4 229 251 22
5 272 294 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02952
MEEETPRQWQRRDSQQTLISLLQLDPSPIESPPESPPPMQDKELPVSSGSSTTGAPGLSGSGGRGAIFYLTRLQR
YSSFATALFASIHLANVSLIPLATRSVPGSETYLLMTRELYQTPLAEPVVVALPVVAHIGAGLALRLLRRWQNMR
RYGAATPAMYALHRKRTTSNKDSVRLWPPLSYVSASGYALTMLYAAHVAVNRVLPLVVEGDSANIGLAYVAHGFT
RHPVLALAAYAGLIATACGHMAWGAARWLGLADGRSSKRRRMGVHAAAAGMTALWAAGGLGVVARGGAAQGWIAA
AYDRMLAAVRL*
Coding >Ophcf2|02952
ATGGAGGAGGAGACGCCCCGTCAGTGGCAGCGCAGAGACTCTCAGCAGACGCTCATTTCGCTCCTACAGCTGGAT
CCATCGCCGATCGAGTCACCGCCCGAGTCGCCGCCCCCGATGCAAGATAAGGAGCTGCCAGTCTCGAGCGGATCG
TCGACAACCGGCGCCCCGGGCCTGAGCGGGAGTGGCGGACGCGGTGCCATCTTCTATCTCACGCGTCTCCAGCGC
TACTCGAGCTTCGCAACCGCTCTCTTCGCCTCCATCCACCTCGCCAACGTGTCGCTGATCCCGCTCGCAACGCGC
TCCGTCCCCGGCTCCGAGACTTACCTCCTAATGACGCGCGAGCTCTACCAGACGCCCCTGGCCGAACCAGTGGTT
GTGGCACTCCCCGTGGTGGCGCACATAGGCGCCGGCCTGGCCCTTCGCCTGCTGCGAAGATGGCAGAACATGCGA
CGGTACGGCGCCGCGACGCCCGCCATGTACGCGCTGCATCGGAAGCGAACGACGTCCAACAAGGATAGCGTCAGG
CTGTGGCCGCCGCTGAGTTATGTCTCGGCTTCCGGCTACGCCCTGACGATGCTCTACGCTGCTCACGTCGCCGTC
AACCGCGTCCTGCCGCTGGTGGTCGAGGGCGATAGCGCAAACATCGGGCTCGCCTATGTCGCTCACGGCTTCACT
CGTCATCCGGTGCTGGCACTGGCTGCCTACGCGGGGCTCATCGCCACCGCCTGCGGACACATGGCTTGGGGCGCT
GCCCGCTGGCTTGGGCTCGCCGACGGCCGGTCTTCCAAACGGCGGCGGATGGGCGTCCATGCTGCGGCGGCTGGT
ATGACTGCGCTCTGGGCTGCGGGTGGGTTGGGTGTCGTGGCGCGGGGAGGGGCGGCGCAGGGCTGGATTGCGGCT
GCCTACGACCGGATGCTGGCTGCGGTACGGCTGTAA
Transcript >Ophcf2|02952
ATGGAGGAGGAGACGCCCCGTCAGTGGCAGCGCAGAGACTCTCAGCAGACGCTCATTTCGCTCCTACAGCTGGAT
CCATCGCCGATCGAGTCACCGCCCGAGTCGCCGCCCCCGATGCAAGATAAGGAGCTGCCAGTCTCGAGCGGATCG
TCGACAACCGGCGCCCCGGGCCTGAGCGGGAGTGGCGGACGCGGTGCCATCTTCTATCTCACGCGTCTCCAGCGC
TACTCGAGCTTCGCAACCGCTCTCTTCGCCTCCATCCACCTCGCCAACGTGTCGCTGATCCCGCTCGCAACGCGC
TCCGTCCCCGGCTCCGAGACTTACCTCCTAATGACGCGCGAGCTCTACCAGACGCCCCTGGCCGAACCAGTGGTT
GTGGCACTCCCCGTGGTGGCGCACATAGGCGCCGGCCTGGCCCTTCGCCTGCTGCGAAGATGGCAGAACATGCGA
CGGTACGGCGCCGCGACGCCCGCCATGTACGCGCTGCATCGGAAGCGAACGACGTCCAACAAGGATAGCGTCAGG
CTGTGGCCGCCGCTGAGTTATGTCTCGGCTTCCGGCTACGCCCTGACGATGCTCTACGCTGCTCACGTCGCCGTC
AACCGCGTCCTGCCGCTGGTGGTCGAGGGCGATAGCGCAAACATCGGGCTCGCCTATGTCGCTCACGGCTTCACT
CGTCATCCGGTGCTGGCACTGGCTGCCTACGCGGGGCTCATCGCCACCGCCTGCGGACACATGGCTTGGGGCGCT
GCCCGCTGGCTTGGGCTCGCCGACGGCCGGTCTTCCAAACGGCGGCGGATGGGCGTCCATGCTGCGGCGGCTGGT
ATGACTGCGCTCTGGGCTGCGGGTGGGTTGGGTGTCGTGGCGCGGGGAGGGGCGGCGCAGGGCTGGATTGCGGCT
GCCTACGACCGGATGCTGGCTGCGGTACGGCTGTAA
Gene >Ophcf2|02952
ATGGAGGAGGAGACGCCCCGTCAGTGGCAGCGCAGAGACTCTCAGCAGACGCTCATTTCGCTCCTACAGCTGGAT
CCATCGCCGATCGAGTCACCGCCCGAGTCGCCGCCCCCGATGCAAGATAAGGAGCTGCCAGTCTCGAGCGGATCG
TCGACAACCGGCGCCCCGGGCCTGAGCGGGAGTGGCGGACGCGGTGCCATCTTCTATCGTACGGCTGTCATCTCC
CTGATCTTTACCGTCTCTGCGCGGCGAAATCACTGACTAGTCCTCTCAGTCACGCGTCTCCAGCGCTACTCGAGC
TTCGCAACCGCTCTCTTCGCCTCCATCCACCTCGCCAACGTGTCGCTGATCCCGCTCGCAACGCGCTCCGTCCCC
GGCTCCGAGACTTACCTCCTAATGACGCGCGAGCTCTACCAGACGCCCCTGGCCGAACCAGTGGTTGTGGCACTC
CCCGTGGTGGCGCACATAGGCGCCGGCCTGGCCCTTCGCCTGCTGCGAAGATGGCAGAACATGCGACGGTACGGC
GCCGCGACGCCCGCCATGTACGCGCTGCATCGGAAGCGAACGACGTCCAACAAGGATAGCGTCAGGCTGTGGCCG
CCGCTGAGTTATGTCTCGGCTTCCGGCTACGCCCTGACGATGCTCTACGCTGCTCACGTCGCCGTCAACCGCGTC
CTGCCGCTGGTGGTCGAGGGCGATAGCGCAAACATCGGGCTCGCCTATGTCGCTCACGGCTTCACTCGTCATCCG
GTGCTGGCACTGGCTGCCTACGCGGGGCTCATCGCCACCGCCTGCGGACACATGGCTTGGGGCGCTGCCCGCTGG
CTTGGGCTCGCCGACGGCCGGTCTTCCAAACGGCGGCGGATGGGCGTCCATGCTGCGGCGGCTGGTATGACTGCG
CTCTGGGCTGCGGGTGGGTTGGGTGTCGTGGCGCGGGGAGGGGCGGCGCAGGGCTGGATTGCGGCTGCCTACGAC
CGGATGCTGGCTGCGGTACGGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail