Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02949
Gene name
Locationscaffold_03:173119..173449
Strand+
Gene length (bp)330
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0838 0.0422 0.9621 0.0488 0.048 0.0124 0.0735 0.1853 0.0957 0.0031

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999716

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.90 0.00 2.70
Alive In ants, during behavior modification 423.01 213.47 632.55
Dead In ants, recently dead 585.34 277.38 893.29

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.024658 yes
Alive Dead 0.098601 no
Dead Fungus 0.024658 yes

Orthologs

Orthofinder run ID4
Orthogroup265
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2459
Ophiocordyceps australis map64 (Brazil) OphauB2|4462
Ophiocordyceps australis map64 (Brazil) OphauB2|7698
Ophiocordyceps camponoti-floridani Ophcf2|02949 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7477
Ophiocordyceps kimflemingae Ophio5|3948
Ophiocordyceps subramaniannii Hirsu2|1076
Ophiocordyceps subramaniannii Hirsu2|3841
Ophiocordyceps subramaniannii Hirsu2|6024
Ophiocordyceps subramaniannii Hirsu2|8728
Ophiocordyceps subramaniannii Hirsu2|9191

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02949
MHLNTLALTLFSTISLANAAAAPVVDSAMPNHHPDLLLADPPQPVTTPRPIQSGMIKGCRAFHYVVKGETCLAIE
AMYGPSIDDLVKWNPAIGPDCTNMWADTWLCVGA*
Coding >Ophcf2|02949
ATGCACCTCAACACCCTCGCCCTCACGCTCTTCAGCACCATCTCCCTCGCCAACGCCGCCGCCGCCCCGGTCGTC
GACTCCGCAATGCCCAACCACCACCCAGACCTGCTGCTCGCGGATCCGCCCCAGCCAGTGACGACGCCACGACCC
ATCCAGTCCGGCATGATCAAGGGCTGCCGGGCCTTCCACTACGTCGTCAAGGGCGAGACCTGCCTCGCCATCGAG
GCCATGTACGGTCCTTCGATCGATGATCTGGTTAAGTGGAATCCGGCTATTGGGCCGGACTGCACTAATATGTGG
GCGGATACATGGCTGTGCGTTGGAGCTTGA
Transcript >Ophcf2|02949
ATGCACCTCAACACCCTCGCCCTCACGCTCTTCAGCACCATCTCCCTCGCCAACGCCGCCGCCGCCCCGGTCGTC
GACTCCGCAATGCCCAACCACCACCCAGACCTGCTGCTCGCGGATCCGCCCCAGCCAGTGACGACGCCACGACCC
ATCCAGTCCGGCATGATCAAGGGCTGCCGGGCCTTCCACTACGTCGTCAAGGGCGAGACCTGCCTCGCCATCGAG
GCCATGTACGGTCCTTCGATCGATGATCTGGTTAAGTGGAATCCGGCTATTGGGCCGGACTGCACTAATATGTGG
GCGGATACATGGCTGTGCGTTGGAGCTTGA
Gene >Ophcf2|02949
ATGCACCTCAACACCCTCGCCCTCACGCTCTTCAGCACCATCTCCCTCGCCAACGCCGCCGCCGCCCCGGTCGTC
GACTCCGCAATGCCCAACCACCACCCAGACCTGCTGCTCGCGGATCCGCCCCAGCCAGTGACGACGCCACGACCC
ATCCAGTCCGGCATGATCAAGGGCTGCCGGGCCTTCCACTACGTCGTCAAGGGCGAGACCTGCCTCGCCATCGAG
GCCATGTACGGTCCTTCGATCGATGATCTGGTTAAGTGGAATCCGGCTATTGGGCCGGACTGCACTAATATGTGG
GCGGATACATGGCTGTGCGTTGGAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail