Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02947
Gene name
Locationscaffold_03:169445..171034
Strand+
Gene length (bp)1589
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 5.3E-31 65 458

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Peroxisomal targeting signal 0.4178 0.5693 0.0845 0.0158 0.1469 0.1057 0.21 0.0469 0.2114 0.3343

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5535
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6424
Ophiocordyceps australis map64 (Brazil) OphauB2|2057
Ophiocordyceps camponoti-floridani Ophcf2|02947 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7479
Ophiocordyceps kimflemingae Ophio5|1452
Ophiocordyceps subramaniannii Hirsu2|6929

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02947
MTLQDALKAALQAVNTLLSLANRLRSLLSRLSSAPGLPVPHPTEPYWLSNPPHAEPRDALPPTADIVIIGSGIAA
AATAHALLELEPDLRVVVLEARRLCSGATGRNGGHVKVVPYHELSRLALRFGHQTARRLVRFQLMHLPALLRLGA
RYPEAEVREVETSDFFVDVQDWHAAQREVEAMRPWLPDVSISVLDGSEARLKTGAGPMIAGAVSYTAGALWPYRL
IASVWHELRSRHSATLSICTQTPVEAVEKNGTSLLVRCRSDSTITARHVVHATNAYAGQLVPLLRRLLTGVLGHM
TAQRPGPTFPVNAHGRKSWSVIYPSSEGFDYATQRPDRTDGSPGDVLLGGGLFRSLDGGLDQVGVWDDSRLDALP
LMHLRGSLSAIFQPECSASAETGATWSGIMGFTGDGIPLVGRLPDQTRTRKRKKKTTDGQEWIIAGFNGEGMVWA
WLSGAALAVMLAGRENEALPPGEGGRPGGKLADWFPAEELAVDKARLRRAELRNLAGLVMA*
Coding >Ophcf2|02947
ATGACCCTCCAAGACGCCCTAAAAGCCGCCCTTCAGGCCGTCAACACCCTCCTCTCTCTCGCCAACCGCCTCCGC
AGCCTCCTCTCCCGCCTCTCATCCGCCCCGGGTCTCCCCGTCCCACATCCAACAGAACCATACTGGCTATCGAAC
CCCCCTCACGCAGAACCACGCGACGCGCTCCCCCCAACCGCCGACATCGTCATCATCGGAAGCGGCATCGCAGCC
GCGGCGACGGCTCATGCTCTTCTCGAACTGGAGCCGGATCTACGCGTCGTCGTCCTCGAGGCTCGTCGGCTGTGT
AGCGGTGCGACGGGCCGTAACGGCGGACACGTCAAGGTCGTTCCCTACCATGAACTCAGCCGGCTCGCTCTTCGG
TTCGGCCATCAGACGGCCCGGCGACTGGTCCGCTTCCAGCTGATGCATCTTCCCGCTCTTCTCCGGCTCGGCGCC
CGATATCCCGAGGCCGAGGTTCGAGAGGTAGAAACGAGCGACTTCTTCGTCGACGTCCAAGACTGGCACGCAGCT
CAGCGCGAGGTCGAAGCCATGCGTCCATGGCTCCCGGACGTATCTATATCCGTACTCGACGGCTCCGAGGCCCGA
CTCAAGACCGGAGCCGGACCCATGATAGCCGGAGCCGTTTCTTACACGGCCGGCGCACTATGGCCCTACCGTCTC
ATCGCCTCCGTCTGGCACGAGTTACGAAGTCGTCACTCCGCCACGCTCTCCATCTGCACGCAGACGCCGGTCGAA
GCCGTCGAGAAGAACGGCACCTCGCTCCTCGTCCGCTGCAGAAGCGACAGCACCATCACCGCTCGCCATGTCGTT
CACGCCACCAACGCCTACGCCGGCCAGCTGGTGCCCCTTCTGCGCCGTCTTCTCACCGGTGTTCTCGGCCATATG
ACGGCCCAGCGGCCCGGCCCGACATTTCCGGTCAATGCCCACGGCCGGAAGTCCTGGTCCGTCATCTACCCGTCC
TCCGAAGGCTTCGATTACGCCACTCAACGGCCGGACCGCACCGACGGCTCTCCCGGCGATGTTCTTCTCGGCGGC
GGCCTGTTCCGCAGCCTCGACGGCGGCCTCGACCAGGTGGGAGTCTGGGATGACTCTCGATTAGACGCCCTACCA
CTCATGCACCTCCGTGGCAGCCTCTCAGCCATCTTCCAGCCCGAGTGCAGCGCCTCAGCCGAGACCGGCGCAACC
TGGTCCGGCATAATGGGCTTCACAGGCGATGGCATCCCCCTCGTCGGCCGTCTCCCCGACCAAACACGAACAAGA
AAGAGAAAGAAGAAGACAACAGACGGACAAGAATGGATAATCGCTGGCTTCAACGGAGAAGGCATGGTCTGGGCC
TGGCTAAGCGGCGCCGCCCTAGCCGTCATGCTCGCAGGCCGCGAGAACGAAGCCCTACCACCGGGAGAAGGCGGT
CGACCGGGGGGCAAGTTGGCTGATTGGTTTCCCGCCGAGGAGCTGGCCGTCGATAAGGCGCGGTTGCGACGGGCC
GAGTTGAGAAACTTGGCTGGCCTGGTGATGGCGTAG
Transcript >Ophcf2|02947
ATGACCCTCCAAGACGCCCTAAAAGCCGCCCTTCAGGCCGTCAACACCCTCCTCTCTCTCGCCAACCGCCTCCGC
AGCCTCCTCTCCCGCCTCTCATCCGCCCCGGGTCTCCCCGTCCCACATCCAACAGAACCATACTGGCTATCGAAC
CCCCCTCACGCAGAACCACGCGACGCGCTCCCCCCAACCGCCGACATCGTCATCATCGGAAGCGGCATCGCAGCC
GCGGCGACGGCTCATGCTCTTCTCGAACTGGAGCCGGATCTACGCGTCGTCGTCCTCGAGGCTCGTCGGCTGTGT
AGCGGTGCGACGGGCCGTAACGGCGGACACGTCAAGGTCGTTCCCTACCATGAACTCAGCCGGCTCGCTCTTCGG
TTCGGCCATCAGACGGCCCGGCGACTGGTCCGCTTCCAGCTGATGCATCTTCCCGCTCTTCTCCGGCTCGGCGCC
CGATATCCCGAGGCCGAGGTTCGAGAGGTAGAAACGAGCGACTTCTTCGTCGACGTCCAAGACTGGCACGCAGCT
CAGCGCGAGGTCGAAGCCATGCGTCCATGGCTCCCGGACGTATCTATATCCGTACTCGACGGCTCCGAGGCCCGA
CTCAAGACCGGAGCCGGACCCATGATAGCCGGAGCCGTTTCTTACACGGCCGGCGCACTATGGCCCTACCGTCTC
ATCGCCTCCGTCTGGCACGAGTTACGAAGTCGTCACTCCGCCACGCTCTCCATCTGCACGCAGACGCCGGTCGAA
GCCGTCGAGAAGAACGGCACCTCGCTCCTCGTCCGCTGCAGAAGCGACAGCACCATCACCGCTCGCCATGTCGTT
CACGCCACCAACGCCTACGCCGGCCAGCTGGTGCCCCTTCTGCGCCGTCTTCTCACCGGTGTTCTCGGCCATATG
ACGGCCCAGCGGCCCGGCCCGACATTTCCGGTCAATGCCCACGGCCGGAAGTCCTGGTCCGTCATCTACCCGTCC
TCCGAAGGCTTCGATTACGCCACTCAACGGCCGGACCGCACCGACGGCTCTCCCGGCGATGTTCTTCTCGGCGGC
GGCCTGTTCCGCAGCCTCGACGGCGGCCTCGACCAGGTGGGAGTCTGGGATGACTCTCGATTAGACGCCCTACCA
CTCATGCACCTCCGTGGCAGCCTCTCAGCCATCTTCCAGCCCGAGTGCAGCGCCTCAGCCGAGACCGGCGCAACC
TGGTCCGGCATAATGGGCTTCACAGGCGATGGCATCCCCCTCGTCGGCCGTCTCCCCGACCAAACACGAACAAGA
AAGAGAAAGAAGAAGACAACAGACGGACAAGAATGGATAATCGCTGGCTTCAACGGAGAAGGCATGGTCTGGGCC
TGGCTAAGCGGCGCCGCCCTAGCCGTCATGCTCGCAGGCCGCGAGAACGAAGCCCTACCACCGGGAGAAGGCGGT
CGACCGGGGGGCAAGTTGGCTGATTGGTTTCCCGCCGAGGAGCTGGCCGTCGATAAGGCGCGGTTGCGACGGGCC
GAGTTGAGAAACTTGGCTGGCCTGGTGATGGCGTAG
Gene >Ophcf2|02947
ATGACCCTCCAAGACGCCCTAAAAGCCGCCCTTCAGGCCGTCAACACCCTCCTCTCTCTCGCCAACCGCCTCCGC
AGCCTCCTCTCCCGCCTCTCATCCGCCCCGGGTCTCCCCGTCCCACATCCAACAGAACCATACTGGCTATCGAAC
CCCCCTCACGCAGAACCACGCGACGCGCTCCCCCCAACCGCCGACATCGTCATCATCGGAAGCGGCATCGCAGCC
GCGGCGACGGCTCATGCTCTTCTCGAACTGGAGCCGGATCTACGCGTCGTCGTCCTCGAGGCTCGTCGGCTGTGT
AGCGGTGCGACGGGCCGTAACGGCGGACACGTCAAGGTCGTTCCCTACCATGAACTCAGCCGGCTCGCTCTTCGG
TTCGGCCATCAGACGGCCCGGCGACTGGTCCGCTTCCAGCTGATGCATCTTCCCGCTCTTCTCCGGCTCGGCGCC
CGATATCCCGAGGCCGAGGTTCGAGAGGTAGAAACGAGCGACTTCTTCGTCGACGTCCAAGACTGGCACGCAGCT
CAGCGCGAGGTCGAAGCCATGCGTCCATGGCTCCCGGACGTATCTATATCCGTACTCGACGGCTCCGAGGCCCGA
CTCAAGGCAATGACACCGTCTCTCCGGACAAGCGCCACCCCACTGCTGACGGAGCTCAGACCGGAGCCGGACCCA
TGATAGCCGGAGCCGTTTCTTACACGGCCGGCGCACTATGGCCCTACCGTCTCATCGCCTCCGTCTGGCACGAGT
TACGAAGTCGTCACTCCGCCACGCTCTCCATCTGCACGCAGACGCCGGTCGAAGCCGTCGAGAAGAACGGCACCT
CGCTCCTCGTCCGCTGCAGAAGCGACAGCACCATCACCGCTCGCCATGTCGTTCACGCCACCAACGCCTACGCCG
GCCAGCTGGTGCCCCTTCTGCGCCGTCTTCTCACCGGTGTTCTCGGCCATATGACGGCCCAGCGGCCCGGCCCGA
CATTTCCGGTCAATGCCCACGGCCGGAAGTCCTGGTCCGTCATCTACCCGTCCTCCGAAGGCTTCGATTACGCCA
CTCAACGGCCGGACCGCACCGACGGCTCTCCCGGCGATGTTCTTCTCGGCGGCGGCCTGTTCCGCAGCCTCGACG
GCGGCCTCGACCAGGTGGGAGTCTGGGATGACTCTCGATTAGACGCCCTACCACTCATGCACCTCCGTGGCAGCC
TCTCAGCCATCTTCCAGCCCGAGTGCAGCGCCTCAGCCGAGACCGGCGCAACCTGGTCCGGCATAATGGGCTTCA
CAGGCGATGGCATCCCCCTCGTCGGCCGTCTCCCCGACCAAACACGAACAAGAAAGAGAAAGAAGAAGACAACAG
ACGGACAAGAATGGATAATCGCTGGCTTCAACGGAGAAGGCATGGTCTGGGCCTGGCTAAGCGGCGCCGCCCTAG
CCGTCATGCTCGCAGGCCGCGAGAACGAAGCCCTACCACCGGGAGAAGGCGGTCGACCGGGGGGCAAGTTGGCTG
ATTGGTTTCCCGCCGAGGAGCTGGCCGTCGATAAGGCGCGGTTGCGACGGGCCGAGTTGAGAAACTTGGCTGGCC
TGGTGATGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail