Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02942
Gene name
Locationscaffold_03:122582..123248
Strand-
Gene length (bp)666
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 8.1E-27 1 80

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7765 0.3915 0.1534 0.0262 0.1162 0.0109 0.1062 0.1066 0.1779 0.1133

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02942
MSHDNWKACLEPKVTGTWNLHNALIETKLDFFVLISSTSGTTGNLGQVNYAAASCFLDSFVQYRHGLGLPCSVVD
LGAVEGVGVLGGKQNVVEAIQLAVMRSSPENSTIPTSPRGLYCNKSQIIIGLTSSRSSGDFTNRLAFTNDARAGL
LTNMNAATSGKTLESSDSEINQLISRFEADPGLLTEPDAIDMVSHEIGRILLRL*
Coding >Ophcf2|02942
ATGAGCCACGATAATTGGAAGGCCTGCCTGGAACCAAAGGTCACGGGCACTTGGAATCTTCACAACGCTCTTATC
GAGACGAAGCTTGACTTCTTCGTCCTCATCTCCTCTACCTCGGGAACGACCGGCAACCTGGGCCAAGTCAACTAT
GCCGCAGCTAGCTGCTTCCTCGACTCGTTCGTCCAATACCGCCATGGGCTCGGATTGCCCTGCTCCGTCGTCGAT
CTCGGCGCCGTCGAGGGCGTCGGTGTTTTGGGCGGCAAGCAGAATGTCGTCGAAGCTATTCAGCTGGCTGTGATG
CGCTCTTCGCCGGAAAACAGCACCATACCGACCAGTCCGCGGGGTTTATACTGTAACAAGAGTCAGATTATCATC
GGCCTGACTTCCTCGAGGTCTTCCGGGGATTTCACGAATCGTCTCGCTTTTACGAACGATGCTCGAGCCGGCCTT
CTTACCAACATGAACGCCGCCACCAGCGGGAAAACGCTTGAGTCTTCAGACTCGGAAATCAACCAGCTCATCAGC
CGGTTCGAGGCCGACCCGGGGCTCCTCACCGAGCCCGACGCCATTGACATGGTCTCGCACGAGATTGGCCGCATC
TTGCTCCGCCTCTAG
Transcript >Ophcf2|02942
ATGAGCCACGATAATTGGAAGGCCTGCCTGGAACCAAAGGTCACGGGCACTTGGAATCTTCACAACGCTCTTATC
GAGACGAAGCTTGACTTCTTCGTCCTCATCTCCTCTACCTCGGGAACGACCGGCAACCTGGGCCAAGTCAACTAT
GCCGCAGCTAGCTGCTTCCTCGACTCGTTCGTCCAATACCGCCATGGGCTCGGATTGCCCTGCTCCGTCGTCGAT
CTCGGCGCCGTCGAGGGCGTCGGTGTTTTGGGCGGCAAGCAGAATGTCGTCGAAGCTATTCAGCTGGCTGTGATG
CGCTCTTCGCCGGAAAACAGCACCATACCGACCAGTCCGCGGGGTTTATACTGTAACAAGAGTCAGATTATCATC
GGCCTGACTTCCTCGAGGTCTTCCGGGGATTTCACGAATCGTCTCGCTTTTACGAACGATGCTCGAGCCGGCCTT
CTTACCAACATGAACGCCGCCACCAGCGGGAAAACGCTTGAGTCTTCAGACTCGGAAATCAACCAGCTCATCAGC
CGGTTCGAGGCCGACCCGGGGCTCCTCACCGAGCCCGACGCCATTGACATGGTCTCGCACGAGATTGGCCGCATC
TTGCTCCGCCTCTAG
Gene >Ophcf2|02942
ATGAGCCACGATAATTGGAAGGCCTGCCTGGAACCAAAGGTCACGGGCACTTGGAATCTTCACAACGCTCTTATC
GAGACGAAGCTTGACTTCTTCGTCCTCATCTCCTCTACCTCGGGAACGACCGGCAACCTGGGCCAAGTCAACTAT
GCCGCAGCTAGCTGCTTCCTCGACTCGTTCGTCCAATACCGCCATGGGCTCGGATTGCCCTGCTCCGTCGTCGAT
CTCGGCGCCGTCGAGGGCGTCGGTGTTTTGGGCGGCAAGCAGGTCAAGCTGGAGCAGTATGCCTACTTTAGAGGC
TAAACTCTCTGTGAGCAGAATGTCGTCGAAGCTATTCAGCTGGCTGTGATGCGCTCTTCGCCGGAAAACAGCACC
ATACCGACCAGTCCGCGGGGTTTATACTGTAACAAGAGTCAGATTATCATCGGCCTGACTTCCTCGAGGTCTTCC
GGGGATTTCACGAATCGTCTCGCTTTTACGAACGATGCTCGAGCCGGCCTTCTTACCAACATGAACGCCGCCACC
AGCGGGAAAACGCTTGAGTCTTCAGACTCGGAAATCAACCAGCTCATCAGCCGGTTCGAGGCCGACCCGGGGCTC
CTCACCGAGCCCGACGCCATTGACATGGTCTCGCACGAGATTGGCCGCATCTTGCTCCGCCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail