Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02926
Gene name
Locationscaffold_03:66853..69909
Strand+
Gene length (bp)3056
Transcript length (bp)2865
Coding sequence length (bp)2865
Protein length (aa) 955

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01465 GRIP GRIP domain 7.6E-16 902 944

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Golgi apparatus Nuclear localization signal 0.6967 0.2537 0.099 0.0894 0.0856 0.0033 0.1542 0.08 0.6741 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1812
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7751
Ophiocordyceps australis map64 (Brazil) OphauB2|2056
Ophiocordyceps camponoti-floridani Ophcf2|02926 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1172
Ophiocordyceps kimflemingae Ophio5|7184
Ophiocordyceps subramaniannii Hirsu2|1783

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02926
MFQRIKGAIDRTIAEEQARQKSLAEGVTPGSGRRNDSSATVKRLRANKPSVDVSDAANPDPAVFEAAFVIDDSDD
MSRAASPRPPLPMKDVAAAREVSGEGEGEGEGEGRSVEENAKGSDEKGSRNEGHNGSPDREVADSSAPAATGPGL
PPEIRQRLRKLDKLEATYPELLRSYRVAHKRATAIEPFEKALRENSPLVSISDPEALIEYLNQLNLRGDMVMQEL
KRVTADRDELKKKQLEEEVVSAQEVKVADENGADVAQLKADLAAKTSETKQLTMRIADLEKELTYSNEKMGELQA
ELAKADTTKSISKKIIEDLQTQVATLQRDKTEAQSKMDELSKKLQPQSQSQTASAPAPAPAQQASGSSKKKGKKK
KGKGGLATAAATDEATEPAAGSSSVQSMEAEMANLRGEMQEKDSQIERLSKQRKTEEDLREEIETLQENLVNIGQ
DHVDAKEKIKALEDERASLTRQIEELESKMSASKSADVPLRKDLDTLRNEFKELESKSSTLQSDLGAAQQLAQTR
FKDLTELREVLQKTQPELKALRQESAELKTAREELTAKAKELKDAERRERDVKREVTRLQQLSADRETERVKAEG
ASRQQVEDVKRLAERRAEADKIELSAKAEQLERELQKAQAEVNKLRPRVKELEEQLHKTRRERTAAQEECDFKAQ
QYSNAQALLSSMRDQTAEISTQLKEARSQAESVEEELGEVRRLLQERTREGETMRGLLADVNEQAEVRIQDMKTL
METAVEERERAENEASATARRTAREAETLRTKVRDLEHSVQSLTLERDTLSRSHQEWTIQKSQLEATTTSLTSEA
NESRTAATHLRNALAASESQLSDSQAQRHDLQRKLDELTQRYDAAMRDAKAAQARLASPSRASFDSVRSVNGGGV
AADTAYLKTILLQFLEQKDGRLRAQLVPVLGKLLKFDKADEAKWMVAVQHIDVR*
Coding >Ophcf2|02926
ATGTTCCAGAGAATCAAGGGCGCCATCGACCGAACCATCGCAGAGGAACAGGCCCGGCAGAAGAGCCTTGCCGAG
GGCGTCACCCCGGGCTCTGGGCGTCGCAACGATAGTTCCGCGACGGTCAAGAGGCTGCGCGCCAACAAGCCGTCG
GTCGACGTCAGTGACGCTGCGAACCCCGATCCTGCTGTTTTCGAGGCGGCTTTCGTCATCGACGACAGCGATGAC
ATGAGTCGCGCGGCGTCGCCTCGTCCGCCACTGCCGATGAAGGATGTTGCTGCAGCCAGAGAGGTTTCCGGCGAG
GGCGAGGGCGAGGGCGAGGGCGAGGGGCGATCGGTCGAGGAAAATGCCAAGGGGTCAGATGAAAAGGGCAGCAGA
AACGAAGGCCACAACGGCAGTCCGGACCGGGAGGTTGCTGATTCGTCGGCGCCGGCCGCTACAGGTCCGGGTCTG
CCGCCGGAGATCAGACAACGTTTGCGCAAATTGGATAAGCTGGAAGCGACGTATCCTGAGCTGCTTCGGTCCTAC
CGCGTCGCTCACAAGCGTGCGACTGCCATTGAGCCGTTCGAAAAGGCTCTCCGCGAGAACTCGCCACTCGTCTCC
ATCAGCGATCCGGAGGCGTTGATAGAGTACCTCAACCAACTGAATCTGCGAGGCGACATGGTCATGCAGGAATTG
AAGCGCGTCACGGCAGACAGAGACGAGTTGAAGAAGAAGCAACTAGAGGAGGAGGTCGTGTCGGCGCAAGAGGTT
AAAGTTGCCGACGAGAACGGGGCAGATGTCGCTCAGCTCAAGGCCGATTTGGCGGCGAAAACGAGCGAGACGAAG
CAGCTCACGATGCGCATCGCAGATCTGGAGAAGGAGTTGACGTACTCTAACGAGAAGATGGGCGAGTTGCAGGCG
GAGCTCGCAAAGGCTGACACGACCAAGTCCATCTCGAAGAAGATCATCGAGGACCTCCAGACTCAGGTGGCGACG
CTACAAAGGGACAAAACGGAGGCTCAGAGCAAGATGGACGAGCTCTCCAAGAAGCTACAGCCGCAATCGCAGTCG
CAGACAGCATCAGCGCCAGCGCCAGCGCCAGCGCAACAGGCCAGCGGCTCCTCCAAAAAAAAGGGCAAGAAGAAG
AAGGGCAAGGGGGGCCTTGCGACAGCCGCTGCGACGGACGAAGCGACGGAGCCGGCAGCAGGGTCTTCTTCGGTC
CAGTCGATGGAGGCGGAGATGGCCAACCTCAGAGGCGAGATGCAAGAAAAGGACAGCCAGATCGAGCGTCTCTCC
AAGCAGCGCAAGACGGAAGAGGATTTGCGCGAGGAGATTGAAACACTGCAGGAGAATCTGGTCAATATCGGACAG
GACCACGTCGACGCAAAGGAGAAGATCAAGGCCCTGGAAGACGAGCGGGCATCGCTCACCAGGCAGATCGAAGAG
CTGGAGTCCAAGATGAGCGCCTCAAAGTCGGCAGACGTCCCGCTGCGAAAAGATCTGGACACGCTGCGGAACGAG
TTCAAGGAGCTCGAGAGCAAGTCGAGCACGCTACAGTCAGACCTAGGCGCTGCTCAGCAACTGGCCCAGACGCGA
TTCAAGGACCTGACGGAACTGCGCGAGGTTCTGCAAAAGACACAGCCCGAGCTCAAGGCTCTCCGGCAAGAATCG
GCCGAGCTCAAGACGGCCCGAGAAGAGCTGACAGCCAAGGCCAAGGAACTCAAAGACGCGGAGCGCAGGGAGCGG
GATGTGAAGCGCGAGGTGACACGGCTACAGCAGCTATCGGCAGACAGAGAGACGGAGAGGGTCAAGGCCGAGGGC
GCGTCGCGGCAGCAGGTGGAAGACGTCAAGCGACTGGCCGAACGGCGTGCCGAAGCAGATAAGATCGAGCTGAGC
GCCAAGGCAGAGCAGCTGGAACGGGAGCTACAAAAGGCGCAAGCCGAGGTGAACAAGTTAAGACCGCGCGTCAAA
GAGCTAGAAGAACAACTCCACAAGACAAGGCGGGAACGCACAGCAGCCCAGGAAGAATGTGACTTCAAAGCTCAG
CAATACAGCAACGCACAGGCTCTCCTCTCCAGCATGCGCGATCAAACAGCCGAGATCTCAACGCAGCTGAAGGAG
GCGAGGTCGCAGGCGGAGTCCGTGGAGGAGGAACTGGGCGAGGTCCGACGACTTCTTCAGGAGCGGACACGCGAG
GGGGAGACGATGAGGGGATTGCTCGCAGACGTGAATGAGCAAGCAGAGGTTCGCATCCAGGACATGAAGACGCTG
ATGGAGACGGCTGTTGAGGAGAGGGAGCGCGCTGAAAACGAAGCCAGCGCAACGGCACGACGTACCGCCCGCGAG
GCCGAAACACTGAGAACAAAAGTCCGCGATCTAGAACACTCAGTCCAATCCCTAACCCTCGAACGCGACACCCTC
TCGAGATCCCACCAAGAATGGACCATTCAAAAATCCCAACTCGAAGCCACAACCACGAGCCTCACATCCGAAGCG
AACGAATCCCGCACAGCAGCAACACACCTCCGCAACGCCCTCGCCGCCTCAGAATCCCAGCTCTCCGACTCGCAA
GCGCAGCGCCACGACCTGCAAAGGAAACTAGATGAACTGACGCAGCGGTACGACGCAGCAATGCGAGACGCGAAA
GCCGCGCAAGCCCGTCTCGCCAGCCCGAGTCGCGCCTCATTCGACTCGGTTCGCAGCGTCAACGGCGGTGGCGTG
GCGGCGGATACGGCCTACCTCAAGACCATACTCTTGCAGTTCCTCGAGCAGAAAGATGGGAGGTTGAGGGCGCAG
CTGGTTCCAGTTTTGGGGAAGCTGCTCAAGTTTGACAAGGCTGATGAGGCCAAGTGGATGGTTGCCGTGCAGCAT
ATTGATGTTCGTTGA
Transcript >Ophcf2|02926
ATGTTCCAGAGAATCAAGGGCGCCATCGACCGAACCATCGCAGAGGAACAGGCCCGGCAGAAGAGCCTTGCCGAG
GGCGTCACCCCGGGCTCTGGGCGTCGCAACGATAGTTCCGCGACGGTCAAGAGGCTGCGCGCCAACAAGCCGTCG
GTCGACGTCAGTGACGCTGCGAACCCCGATCCTGCTGTTTTCGAGGCGGCTTTCGTCATCGACGACAGCGATGAC
ATGAGTCGCGCGGCGTCGCCTCGTCCGCCACTGCCGATGAAGGATGTTGCTGCAGCCAGAGAGGTTTCCGGCGAG
GGCGAGGGCGAGGGCGAGGGCGAGGGGCGATCGGTCGAGGAAAATGCCAAGGGGTCAGATGAAAAGGGCAGCAGA
AACGAAGGCCACAACGGCAGTCCGGACCGGGAGGTTGCTGATTCGTCGGCGCCGGCCGCTACAGGTCCGGGTCTG
CCGCCGGAGATCAGACAACGTTTGCGCAAATTGGATAAGCTGGAAGCGACGTATCCTGAGCTGCTTCGGTCCTAC
CGCGTCGCTCACAAGCGTGCGACTGCCATTGAGCCGTTCGAAAAGGCTCTCCGCGAGAACTCGCCACTCGTCTCC
ATCAGCGATCCGGAGGCGTTGATAGAGTACCTCAACCAACTGAATCTGCGAGGCGACATGGTCATGCAGGAATTG
AAGCGCGTCACGGCAGACAGAGACGAGTTGAAGAAGAAGCAACTAGAGGAGGAGGTCGTGTCGGCGCAAGAGGTT
AAAGTTGCCGACGAGAACGGGGCAGATGTCGCTCAGCTCAAGGCCGATTTGGCGGCGAAAACGAGCGAGACGAAG
CAGCTCACGATGCGCATCGCAGATCTGGAGAAGGAGTTGACGTACTCTAACGAGAAGATGGGCGAGTTGCAGGCG
GAGCTCGCAAAGGCTGACACGACCAAGTCCATCTCGAAGAAGATCATCGAGGACCTCCAGACTCAGGTGGCGACG
CTACAAAGGGACAAAACGGAGGCTCAGAGCAAGATGGACGAGCTCTCCAAGAAGCTACAGCCGCAATCGCAGTCG
CAGACAGCATCAGCGCCAGCGCCAGCGCCAGCGCAACAGGCCAGCGGCTCCTCCAAAAAAAAGGGCAAGAAGAAG
AAGGGCAAGGGGGGCCTTGCGACAGCCGCTGCGACGGACGAAGCGACGGAGCCGGCAGCAGGGTCTTCTTCGGTC
CAGTCGATGGAGGCGGAGATGGCCAACCTCAGAGGCGAGATGCAAGAAAAGGACAGCCAGATCGAGCGTCTCTCC
AAGCAGCGCAAGACGGAAGAGGATTTGCGCGAGGAGATTGAAACACTGCAGGAGAATCTGGTCAATATCGGACAG
GACCACGTCGACGCAAAGGAGAAGATCAAGGCCCTGGAAGACGAGCGGGCATCGCTCACCAGGCAGATCGAAGAG
CTGGAGTCCAAGATGAGCGCCTCAAAGTCGGCAGACGTCCCGCTGCGAAAAGATCTGGACACGCTGCGGAACGAG
TTCAAGGAGCTCGAGAGCAAGTCGAGCACGCTACAGTCAGACCTAGGCGCTGCTCAGCAACTGGCCCAGACGCGA
TTCAAGGACCTGACGGAACTGCGCGAGGTTCTGCAAAAGACACAGCCCGAGCTCAAGGCTCTCCGGCAAGAATCG
GCCGAGCTCAAGACGGCCCGAGAAGAGCTGACAGCCAAGGCCAAGGAACTCAAAGACGCGGAGCGCAGGGAGCGG
GATGTGAAGCGCGAGGTGACACGGCTACAGCAGCTATCGGCAGACAGAGAGACGGAGAGGGTCAAGGCCGAGGGC
GCGTCGCGGCAGCAGGTGGAAGACGTCAAGCGACTGGCCGAACGGCGTGCCGAAGCAGATAAGATCGAGCTGAGC
GCCAAGGCAGAGCAGCTGGAACGGGAGCTACAAAAGGCGCAAGCCGAGGTGAACAAGTTAAGACCGCGCGTCAAA
GAGCTAGAAGAACAACTCCACAAGACAAGGCGGGAACGCACAGCAGCCCAGGAAGAATGTGACTTCAAAGCTCAG
CAATACAGCAACGCACAGGCTCTCCTCTCCAGCATGCGCGATCAAACAGCCGAGATCTCAACGCAGCTGAAGGAG
GCGAGGTCGCAGGCGGAGTCCGTGGAGGAGGAACTGGGCGAGGTCCGACGACTTCTTCAGGAGCGGACACGCGAG
GGGGAGACGATGAGGGGATTGCTCGCAGACGTGAATGAGCAAGCAGAGGTTCGCATCCAGGACATGAAGACGCTG
ATGGAGACGGCTGTTGAGGAGAGGGAGCGCGCTGAAAACGAAGCCAGCGCAACGGCACGACGTACCGCCCGCGAG
GCCGAAACACTGAGAACAAAAGTCCGCGATCTAGAACACTCAGTCCAATCCCTAACCCTCGAACGCGACACCCTC
TCGAGATCCCACCAAGAATGGACCATTCAAAAATCCCAACTCGAAGCCACAACCACGAGCCTCACATCCGAAGCG
AACGAATCCCGCACAGCAGCAACACACCTCCGCAACGCCCTCGCCGCCTCAGAATCCCAGCTCTCCGACTCGCAA
GCGCAGCGCCACGACCTGCAAAGGAAACTAGATGAACTGACGCAGCGGTACGACGCAGCAATGCGAGACGCGAAA
GCCGCGCAAGCCCGTCTCGCCAGCCCGAGTCGCGCCTCATTCGACTCGGTTCGCAGCGTCAACGGCGGTGGCGTG
GCGGCGGATACGGCCTACCTCAAGACCATACTCTTGCAGTTCCTCGAGCAGAAAGATGGGAGGTTGAGGGCGCAG
CTGGTTCCAGTTTTGGGGAAGCTGCTCAAGTTTGACAAGGCTGATGAGGCCAAGTGGATGGTTGCCGTGCAGCAT
ATTGATGTTCGTTGA
Gene >Ophcf2|02926
ATGTTCCAGGTCCGGCCCGTGTTCCGACTTGGGAGCCGCCATTCGTGCTGACCGACCGACATAGAGAATCAAGGG
CGCCATCGACCGAACCATCGCAGAGGAACAGGCCCGGCAGAAGAGCCTTGCCGAGGGCGTCACCCCGGGCTCTGG
GCGTCGCAACGATAGTTCCGCGACGGTCAAGAGGCTGCGCGCCAACAAGCCGTCGGTCGACGTCAGTGACGCTGC
GAACCCCGATCCTGCTGTTTTCGAGGCGGCTTTCGTCATCGACGACAGCGATGACATGAGTCGCGCGGCGTCGCC
TCGTCCGCCACTGCCGATGAAGGATGTTGCTGCAGCCAGAGAGGTTTCCGGCGAGGGCGAGGGCGAGGGCGAGGG
CGAGGGGCGATCGGTCGAGGAAAATGCCAAGGGGTCAGATGAAAAGGGCAGCAGAAACGAAGGCCACAACGGCAG
TCCGGACCGGGAGGTTGCTGATTCGTCGGCGCCGGCCGCTACAGGTCCGGGTCTGCCGCCGGAGATCAGACAACG
TTTGCGCAAATTGGATAAGCTGGAAGCGACGTATCCTGGTGAGTCTCGCGTTGTTTGCCCCCTCCCCCTTCTCTC
GGCTAAAGGCGTCGCGCAGAGCTGCTTCGGTCCTACCGCGTCGCTCACAAGCGTGCGACTGCCATTGAGCCGTTC
GAAAAGGCTCTCCGCGAGAACTCGCCACTCGTCTCCATCAGCGATCCGGAGGCGTTGATAGAGTACCTCAACCAA
CTGAATCTGCGAGGCGACATGGTCATGCAGGAATTGAAGCGCGTCACGGCAGACAGAGACGAGTTGAAGAAGAAG
CAACTAGAGGAGGAGGTCGTGTCGGCGCAAGAGGTTAAAGTTGCCGACGAGAACGGGGCAGATGTCGCTCAGCTC
AAGGCCGATTTGGCGGCGAAAACGAGCGAGACGAAGCAGCTCACGATGCGCATCGCAGATCTGGAGAAGGAGTTG
ACGTACTCTAACGAGAAGATGGGCGAGTTGCAGGCGGAGCTCGCAAAGGCTGACACGACCAAGTCCATCTCGAAG
AAGATCATCGAGGACCTCCAGACTCAGGTGGCGACGCTACAAAGGGACAAAACGGAGGCTCAGAGCAAGATGGAC
GAGCTCTCCAAGAAGCTACAGCCGCAATCGCAGTCGCAGACAGCATCAGCGCCAGCGCCAGCGCCAGCGCAACAG
GCCAGCGGCTCCTCCAAAAAAAAGGGCAAGAAGAAGAAGGGCAAGGGGGGCCTTGCGACAGCCGCTGCGACGGAC
GAAGCGACGGAGCCGGCAGCAGGGTCTTCTTCGGTCCAGTCGATGGAGGCGGAGATGGCCAACCTCAGAGGCGAG
ATGCAAGAAAAGGACAGCCAGATCGAGCGTCTCTCCAAGCAGCGCAAGACGGAAGAGGATTTGCGCGAGGAGATT
GAAACACTGCAGGAGAATCTGGTCAATATCGGACAGGACCACGTCGACGCAAAGGAGAAGATCAAGGCCCTGGAA
GACGAGCGGGCATCGCTCACCAGGCAGATCGAAGAGCTGGAGTCCAAGATGAGCGCCTCAAAGTCGGCAGACGTC
CCGCTGCGAAAAGATCTGGACACGCTGCGGAACGAGTTCAAGGAGCTCGAGAGCAAGTCGAGCACGCTACAGTCA
GACCTAGGCGCTGCTCAGCAACTGGCCCAGACGCGATTCAAGGACCTGACGGAACTGCGCGAGGTTCTGCAAAAG
ACACAGCCCGAGCTCAAGGCTCTCCGGCAAGAATCGGCCGAGCTCAAGACGGCCCGAGAAGAGCTGACAGCCAAG
GCCAAGGAACTCAAAGACGCGGAGCGCAGGGAGCGGGATGTGAAGCGCGAGGTGACACGGCTACAGCAGCTATCG
GCAGACAGAGAGACGGAGAGGGTCAAGGCCGAGGGCGCGTCGCGGCAGCAGGTGGAAGACGTCAAGCGACTGGCC
GAACGGCGTGCCGAAGCAGATAAGATCGAGCTGAGCGCCAAGGCAGAGCAGCTGGAACGGGAGCTACAAAAGGCG
CAAGCCGAGGTGAACAAGTTAAGACCGCGCGTCAAAGAGCTAGAAGAACAACTCCACAAGACAAGGCGGGAACGC
ACAGCAGCCCAGGAAGAATGTGACTTCAAAGCTCAGCAATACAGCAACGCACAGGCTCTCCTCTCCAGCATGCGC
GATCAAACAGCCGAGATCTCAACGCAGCTGAAGGAGGCGAGGTCGCAGGCGGAGTCCGTGGAGGAGGAACTGGGC
GAGGTCCGACGACTTCTTCAGGAGCGGACACGCGAGGGGGAGACGATGAGGGGATTGCTCGCAGACGTGAATGAG
CAAGCAGAGGTTCGCATCCAGGACATGAAGACGCTGATGGAGACGGCTGTTGAGGAGAGGGAGCGCGCTGAAAAC
GAAGCCAGCGCAACGGCACGACGTACCGCCCGCGAGGCCGAAACACTGAGAACAAAAGTCCGCGATCTAGAACAC
TCAGTCCAATCCCTAACCCTCGAACGCGACACCCTCTCGAGATCCCACCAAGAATGGACCATTCAAAAATCCCAA
CTCGAAGCCACAACCACGAGCCTCACATCCGAAGCGAACGAATCCCGCACAGCAGCAACACACCTCCGCAACGCC
CTCGCCGCCTCAGAATCCCAGCTCTCCGACTCGCAAGCGCAGCGCCACGACCTGCAAAGGAAACTAGATGAACTG
ACGCAGCGGTACGACGCAGCAATGCGAGACGCGAAAGCCGCGCAAGCCCGTCTCGCCAGCCCGAGTCGCGCCTCA
TTCGACTCGGTTCGCAGCGTCAACGGCGGTGGCGTGGCGGCGGATACGGCCTACCTCAAGACCATACTCTTGCAG
TTCCTCGAGCAGAAAGATGGGAGGTTGAGGGCGCAGCTGGTTCCAGTTTTGGGGAAGCTGCTCAAGTTTGACAAG
TGAGCTTCCTTCTCCCCTTTGTTCTCTCTCTCTCTCTCTTTGGGGTTTTATGAGGTGGCGAAGCTGACGACGGGT
GTAGGGCTGATGAGGCCAAGTGGATGGTTGCCGTGCAGCATATTGATGTTCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail