Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02922
Gene name
Locationscaffold_03:59111..60455
Strand+
Gene length (bp)1344
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08711 Med26 TFIIS helical bundle-like domain 4.3E-10 269 318

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4092 0.7694 0.1614 0.0374 0.074 0.0014 0.0211 0.014 0.0303 0.0003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1022
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6149
Ophiocordyceps australis map64 (Brazil) OphauB2|4726
Ophiocordyceps camponoti-floridani Ophcf2|02922 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4913
Ophiocordyceps kimflemingae Ophio5|180
Ophiocordyceps kimflemingae Ophio5|199
Ophiocordyceps subramaniannii Hirsu2|9228

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02922
MSDVDSPTANEPVDDVQEQNFQDEIAAANSDRDSDLLSEIDENQFEDYDPETANIEDRPVDIDEDMARTLKATKR
KRPDGEAPKKPREGRREKKRRDRDDEIPADEDAGADAGKAPRRSRRAGDGEGRRVKEAETPQEAPKEEQLTPEER
RKRAIDRALDAAIKKGGGGGKRRRKDEIDLEDEIDEKLAQLKYQMEQACQADNAARESGQPALHKLKLLPEVNAI
LNRNNVQHAVLDPDTNFLQHVKFFLEPLNDGSLPAYNIQRDIFSALTRLSVEKEALLSSGIGKVVLFYTRSKKPE
PSIRRMAERLLGEWSRPILKRTDDYKKRHVETREFDYQAAKMAQRQKTNSQFTLSQRPSQSAREAFLAPQGNNNQ
ARMASLPSSYTIAPKSTFDGSQGQDHRPLGASGMEAFRRMTQKTQRAKKRT*
Coding >Ophcf2|02922
ATGTCGGACGTGGACTCGCCAACCGCCAACGAGCCGGTCGATGATGTCCAGGAGCAGAATTTTCAAGATGAAATC
GCCGCCGCCAATTCTGATCGCGACTCTGACCTCCTTTCCGAGATCGATGAGAACCAGTTCGAAGATTATGACCCT
GAGACGGCGAACATTGAGGACCGGCCAGTAGATATCGACGAAGACATGGCCCGAACCCTGAAGGCGACTAAGAGG
AAGCGACCCGACGGAGAGGCCCCCAAAAAACCCCGAGAGGGTCGGCGGGAGAAGAAGAGGAGAGATCGTGACGAC
GAGATCCCAGCAGACGAAGATGCCGGTGCAGACGCTGGCAAGGCCCCACGACGCTCTAGACGGGCTGGCGACGGA
GAAGGGCGTCGGGTCAAGGAAGCCGAGACACCACAGGAAGCGCCCAAAGAGGAACAGCTGACGCCGGAGGAGAGG
CGGAAGCGAGCCATCGACCGGGCCCTGGACGCGGCTATCAAAAAGGGCGGCGGCGGCGGCAAGCGCAGGCGCAAG
GACGAGATTGATCTCGAGGATGAGATTGACGAGAAGCTCGCGCAACTCAAATATCAGATGGAGCAGGCCTGTCAG
GCCGACAACGCAGCGCGCGAATCGGGCCAACCGGCACTGCACAAGCTCAAGCTGCTGCCGGAGGTCAACGCGATC
CTCAACCGCAACAACGTGCAGCATGCGGTGCTTGATCCGGACACCAACTTTCTACAGCACGTCAAGTTCTTCCTC
GAGCCGCTGAACGACGGATCACTCCCTGCATACAACATCCAGCGCGACATCTTTTCCGCACTGACCCGGCTCAGC
GTCGAGAAGGAGGCGCTTCTCAGCAGCGGCATCGGCAAGGTGGTGCTCTTCTACACCCGCAGCAAGAAGCCGGAG
CCGAGCATTAGGCGCATGGCGGAACGGCTACTAGGTGAATGGAGTCGGCCAATCCTCAAGCGAACCGACGATTAC
AAGAAGCGCCACGTCGAAACGCGCGAGTTTGACTACCAGGCGGCCAAGATGGCGCAGCGGCAGAAGACGAATTCG
CAGTTTACTCTCTCGCAACGACCGTCGCAATCAGCCCGTGAAGCTTTCCTGGCGCCGCAGGGCAACAACAACCAA
GCACGCATGGCCAGCCTGCCGTCGAGCTACACGATTGCGCCCAAGAGCACATTTGACGGCTCGCAGGGACAGGAT
CATCGGCCGCTCGGGGCCAGTGGGATGGAGGCTTTCCGGAGGATGACGCAGAAGACGCAGAGGGCGAAGAAGCGG
ACGTAG
Transcript >Ophcf2|02922
ATGTCGGACGTGGACTCGCCAACCGCCAACGAGCCGGTCGATGATGTCCAGGAGCAGAATTTTCAAGATGAAATC
GCCGCCGCCAATTCTGATCGCGACTCTGACCTCCTTTCCGAGATCGATGAGAACCAGTTCGAAGATTATGACCCT
GAGACGGCGAACATTGAGGACCGGCCAGTAGATATCGACGAAGACATGGCCCGAACCCTGAAGGCGACTAAGAGG
AAGCGACCCGACGGAGAGGCCCCCAAAAAACCCCGAGAGGGTCGGCGGGAGAAGAAGAGGAGAGATCGTGACGAC
GAGATCCCAGCAGACGAAGATGCCGGTGCAGACGCTGGCAAGGCCCCACGACGCTCTAGACGGGCTGGCGACGGA
GAAGGGCGTCGGGTCAAGGAAGCCGAGACACCACAGGAAGCGCCCAAAGAGGAACAGCTGACGCCGGAGGAGAGG
CGGAAGCGAGCCATCGACCGGGCCCTGGACGCGGCTATCAAAAAGGGCGGCGGCGGCGGCAAGCGCAGGCGCAAG
GACGAGATTGATCTCGAGGATGAGATTGACGAGAAGCTCGCGCAACTCAAATATCAGATGGAGCAGGCCTGTCAG
GCCGACAACGCAGCGCGCGAATCGGGCCAACCGGCACTGCACAAGCTCAAGCTGCTGCCGGAGGTCAACGCGATC
CTCAACCGCAACAACGTGCAGCATGCGGTGCTTGATCCGGACACCAACTTTCTACAGCACGTCAAGTTCTTCCTC
GAGCCGCTGAACGACGGATCACTCCCTGCATACAACATCCAGCGCGACATCTTTTCCGCACTGACCCGGCTCAGC
GTCGAGAAGGAGGCGCTTCTCAGCAGCGGCATCGGCAAGGTGGTGCTCTTCTACACCCGCAGCAAGAAGCCGGAG
CCGAGCATTAGGCGCATGGCGGAACGGCTACTAGGTGAATGGAGTCGGCCAATCCTCAAGCGAACCGACGATTAC
AAGAAGCGCCACGTCGAAACGCGCGAGTTTGACTACCAGGCGGCCAAGATGGCGCAGCGGCAGAAGACGAATTCG
CAGTTTACTCTCTCGCAACGACCGTCGCAATCAGCCCGTGAAGCTTTCCTGGCGCCGCAGGGCAACAACAACCAA
GCACGCATGGCCAGCCTGCCGTCGAGCTACACGATTGCGCCCAAGAGCACATTTGACGGCTCGCAGGGACAGGAT
CATCGGCCGCTCGGGGCCAGTGGGATGGAGGCTTTCCGGAGGATGACGCAGAAGACGCAGAGGGCGAAGAAGCGG
ACGTAG
Gene >Ophcf2|02922
ATGTCGGACGTGGACTCGCCAACCGCCAACGAGCCGGTCGATGATGTCCAGGAGCAGAATTTTCAAGATGAAATC
GCCGCCGCCAATTCTGATCGCGACTCTGACCTCCTTTCCGAGATCGATGAGAACCAGTTCGAAGATTATGACCCT
GAGACGGCGAACATTGAGGACCGGCCAGTAGATATCGACGAAGACATGGCCCGAACCCTGAAGGCGACTAAGAGG
AAGCGACCCGACGGAGAGGCCCCCAAAAAACCCCGAGAGGGTCGGCGGGAGAAGAAGAGGAGAGATCGTGACGAC
GAGATCCCAGCAGACGAAGATGCCGGTGCAGACGCTGGCAAGGCCCCACGACGCTCTAGACGGGCTGGCGACGGA
GAAGGGCGTCGGGTCAAGGAAGCCGAGACACCACAGGAAGCGCCCAAAGAGGAACAGCTGACGCCGGAGGAGAGG
CGGAAGCGAGCCATCGACCGGGCCCTGGACGCGGCTATCAAAAAGGGCGGCGGCGGCGGCAAGCGCAGGCGCAAG
GACGAGATTGATCTCGAGGATGAGATTGACGAGAAGCTCGCGCAACTCAAATATCAGATGGAGCAGGCCTGTCAG
GCCGACAACGCAGCGCGCGAATCGGGCCAACCGGCACTGCACAAGCTCAAGCTGCTGCCGGAGGTCAACGCGATC
CTCAACCGCAACAACGTGCAGCATGCGGTGCTTGATCCGGACACCAACTTTCTACAGCACGTCAAGTTCTTCCTC
GAGCCGCTGAACGACGGATCACTCCCTGCATACAACATCCAGCGCGACATCTTTTCCGCACTGACCCGGCTCAGC
GTCGAGAAGGAGGCGCTTCTCAGCAGCGGCATCGGCAAGGTGGTGCTCTTCTACACCCGCAGCAAGAAGCCGGAG
CCGAGCATTAGGCGCATGGCGGAACGGCTACTAGGTGAATGGAGTCGGCCAATCCTCAAGCGAACCGACGATTAC
AAGAAGCGCCACGTCGAAACGCGCGAGTTTGACTACCAGTGCGTCCCCTCTATCCATGCGTGTTTTTCCATGTCG
TGTCGTGCTGACGTGGGATACAACAGGGCGGCCAAGATGGCGCAGCGGCAGAAGACGAATTCGCAGTTTACTCTC
TCGCAACGACCGTCGCAATCAGCCCGTGAAGCTTTCCTGGCGCCGCAGGGCAACAACAACCAAGCACGCATGGCC
AGCCTGCCGTCGAGCTACACGATTGCGCCCAAGAGCACATTTGACGGCTCGCAGGGACAGGATCATCGGCCGCTC
GGGGCCAGTGGGATGGAGGCTTTCCGGAGGATGACGCAGAAGACGCAGAGGGCGAAGAAGCGGACGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail