Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02910
Gene name
Locationscaffold_02:5088674..5090648
Strand+
Gene length (bp)1974
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 6.0E-202 57 595

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 265 287 22
2 341 363 22
3 373 395 22
4 408 427 19
5 442 464 22
6 501 523 22
7 527 559 32
8 566 588 22
9 598 629 31

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02910
MHLRTALAAALAASASAFYLPGVAPTSYKPGDRVPLQVNSIRPVAAPQDNRLHSVVSYDYYHPDFHFCEPSGGPQ
YVPESLGSILSGDRLMTSPFELLMAKNETCKPLCKASYPVESKRFVNERIEEAYSLNWLVDGLPAGQQIKDDLTG
TTFYSPGFQLGGYFLSSDEEEELSLNNHYEIWIEYHPVNGRENELRVVGAVVQPSSKLYTGEVDCADGHSPVSLT
SGDEEQQVQFSYSVYWRKSETAWATRWDKYLHVFDPKIHWFWLIDTAVIVVILVLTVMSVLVRTLKKDIARYNRL
DQISLDDLSGTSVVEDGVQEDSGWKLIHGDVFRTPPRPLLLSVLLGNGAQLFVMTGLTIVFALLGFLSPSNRGSL
GTIMIILYTLLGSVGGYTSARTYKAMSGEQWKLNIALTPLLVPGIVFSAFFLLDLFLWAKRSSGAVPFTTMLVII
IIWFVISIPLSIVGSWMGFRSPQIEAPVRTNQIPRQIPPATTYLQPIPSMLIVGLLPFGAIFVELYFIMSSIWFS
RIYYMFGFLFLCYGLMIVVCAAVTVLMTYFLLCAENYNWQWRSFLAAGMSGGYIFLNCLLYLLTKVKLGGLAGIV
LYVGYSALISFLFFILAGSIGYFASWWFVRKIYSSIKID*
Coding >Ophcf2|02910
ATGCACCTCCGAACCGCCCTCGCGGCGGCGCTGGCGGCTTCGGCATCTGCCTTTTATCTCCCGGGAGTGGCGCCA
ACCTCCTACAAACCAGGTGATCGCGTTCCCCTCCAGGTCAACAGCATCCGGCCCGTCGCTGCGCCTCAAGATAAC
CGCCTGCATTCGGTCGTCTCTTACGACTATTACCATCCGGACTTTCACTTCTGCGAACCATCCGGCGGCCCGCAG
TATGTGCCCGAGAGCCTGGGGAGTATCCTCTCGGGTGACAGGCTGATGACGTCGCCCTTTGAGCTGCTCATGGCC
AAGAACGAAACCTGCAAGCCTCTATGCAAAGCATCCTACCCCGTCGAAAGCAAGAGGTTCGTCAACGAGCGGATA
GAGGAGGCCTATAGTCTCAACTGGCTCGTCGACGGCCTGCCTGCTGGACAGCAAATCAAAGACGACTTGACCGGC
ACAACCTTTTACAGCCCTGGCTTCCAGCTTGGCGGCTACTTCCTCTCGTCCGACGAGGAAGAGGAACTCTCCCTT
AATAACCATTACGAGATTTGGATCGAATACCATCCGGTCAATGGTCGGGAGAATGAGCTCCGTGTTGTCGGCGCC
GTCGTCCAGCCCAGCTCCAAGTTATACACGGGAGAGGTCGATTGCGCCGACGGCCACTCGCCCGTCTCTCTAACT
TCTGGCGATGAGGAGCAGCAGGTGCAGTTTAGCTACAGCGTCTACTGGCGCAAGTCGGAAACGGCCTGGGCCACG
CGCTGGGACAAGTATCTACACGTCTTCGACCCCAAGATCCACTGGTTCTGGCTCATTGACACGGCCGTCATTGTC
GTCATACTCGTCCTGACCGTCATGTCCGTGCTCGTCAGGACATTGAAAAAGGACATTGCACGGTACAATCGTCTG
GATCAGATCAGTCTCGATGACCTGAGCGGCACTTCGGTCGTCGAGGACGGTGTCCAAGAGGACTCGGGCTGGAAG
CTGATTCACGGCGACGTCTTTCGTACGCCGCCCCGACCCTTACTGCTGTCTGTGCTACTTGGCAACGGCGCCCAA
CTGTTTGTCATGACTGGCTTGACAATCGTCTTTGCCCTCCTCGGCTTTCTGTCACCTTCGAACCGTGGATCCCTG
GGAACCATCATGATCATCCTTTACACGCTTCTCGGTTCCGTTGGCGGTTACACCTCAGCCAGAACCTACAAGGCC
ATGTCTGGCGAACAATGGAAACTCAACATTGCCTTGACGCCGCTGCTGGTTCCCGGCATCGTCTTCTCTGCCTTC
TTTCTCCTCGACCTCTTCTTGTGGGCCAAGCGTTCGTCCGGTGCGGTACCCTTCACGACGATGCTCGTCATCATC
ATCATCTGGTTTGTCATATCCATACCGCTGTCCATTGTCGGATCGTGGATGGGCTTCCGTAGCCCTCAGATCGAG
GCGCCGGTGCGCACGAATCAGATTCCTCGTCAGATCCCGCCGGCCACCACATATCTCCAGCCGATCCCCAGCATG
CTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTCGTGGAGCTCTACTTCATCATGAGCTCCATCTGGTTCAGT
CGAATCTATTACATGTTTGGGTTCCTCTTTCTCTGCTACGGCCTGATGATTGTCGTCTGCGCCGCCGTCACCGTC
CTCATGACCTACTTCCTTCTTTGCGCCGAAAACTACAACTGGCAGTGGAGGTCGTTCCTCGCCGCTGGCATGAGC
GGCGGTTACATCTTCCTCAACTGCCTCCTCTATCTTCTCACCAAAGTGAAGCTCGGCGGGCTCGCTGGCATCGTC
CTTTACGTTGGCTACAGCGCGCTCATCTCCTTTTTGTTCTTCATTCTTGCCGGTTCCATTGGCTACTTTGCGAGC
TGGTGGTTCGTGAGGAAGATTTACTCCTCTATCAAGATTGATTAG
Transcript >Ophcf2|02910
ATGCACCTCCGAACCGCCCTCGCGGCGGCGCTGGCGGCTTCGGCATCTGCCTTTTATCTCCCGGGAGTGGCGCCA
ACCTCCTACAAACCAGGTGATCGCGTTCCCCTCCAGGTCAACAGCATCCGGCCCGTCGCTGCGCCTCAAGATAAC
CGCCTGCATTCGGTCGTCTCTTACGACTATTACCATCCGGACTTTCACTTCTGCGAACCATCCGGCGGCCCGCAG
TATGTGCCCGAGAGCCTGGGGAGTATCCTCTCGGGTGACAGGCTGATGACGTCGCCCTTTGAGCTGCTCATGGCC
AAGAACGAAACCTGCAAGCCTCTATGCAAAGCATCCTACCCCGTCGAAAGCAAGAGGTTCGTCAACGAGCGGATA
GAGGAGGCCTATAGTCTCAACTGGCTCGTCGACGGCCTGCCTGCTGGACAGCAAATCAAAGACGACTTGACCGGC
ACAACCTTTTACAGCCCTGGCTTCCAGCTTGGCGGCTACTTCCTCTCGTCCGACGAGGAAGAGGAACTCTCCCTT
AATAACCATTACGAGATTTGGATCGAATACCATCCGGTCAATGGTCGGGAGAATGAGCTCCGTGTTGTCGGCGCC
GTCGTCCAGCCCAGCTCCAAGTTATACACGGGAGAGGTCGATTGCGCCGACGGCCACTCGCCCGTCTCTCTAACT
TCTGGCGATGAGGAGCAGCAGGTGCAGTTTAGCTACAGCGTCTACTGGCGCAAGTCGGAAACGGCCTGGGCCACG
CGCTGGGACAAGTATCTACACGTCTTCGACCCCAAGATCCACTGGTTCTGGCTCATTGACACGGCCGTCATTGTC
GTCATACTCGTCCTGACCGTCATGTCCGTGCTCGTCAGGACATTGAAAAAGGACATTGCACGGTACAATCGTCTG
GATCAGATCAGTCTCGATGACCTGAGCGGCACTTCGGTCGTCGAGGACGGTGTCCAAGAGGACTCGGGCTGGAAG
CTGATTCACGGCGACGTCTTTCGTACGCCGCCCCGACCCTTACTGCTGTCTGTGCTACTTGGCAACGGCGCCCAA
CTGTTTGTCATGACTGGCTTGACAATCGTCTTTGCCCTCCTCGGCTTTCTGTCACCTTCGAACCGTGGATCCCTG
GGAACCATCATGATCATCCTTTACACGCTTCTCGGTTCCGTTGGCGGTTACACCTCAGCCAGAACCTACAAGGCC
ATGTCTGGCGAACAATGGAAACTCAACATTGCCTTGACGCCGCTGCTGGTTCCCGGCATCGTCTTCTCTGCCTTC
TTTCTCCTCGACCTCTTCTTGTGGGCCAAGCGTTCGTCCGGTGCGGTACCCTTCACGACGATGCTCGTCATCATC
ATCATCTGGTTTGTCATATCCATACCGCTGTCCATTGTCGGATCGTGGATGGGCTTCCGTAGCCCTCAGATCGAG
GCGCCGGTGCGCACGAATCAGATTCCTCGTCAGATCCCGCCGGCCACCACATATCTCCAGCCGATCCCCAGCATG
CTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTCGTGGAGCTCTACTTCATCATGAGCTCCATCTGGTTCAGT
CGAATCTATTACATGTTTGGGTTCCTCTTTCTCTGCTACGGCCTGATGATTGTCGTCTGCGCCGCCGTCACCGTC
CTCATGACCTACTTCCTTCTTTGCGCCGAAAACTACAACTGGCAGTGGAGGTCGTTCCTCGCCGCTGGCATGAGC
GGCGGTTACATCTTCCTCAACTGCCTCCTCTATCTTCTCACCAAAGTGAAGCTCGGCGGGCTCGCTGGCATCGTC
CTTTACGTTGGCTACAGCGCGCTCATCTCCTTTTTGTTCTTCATTCTTGCCGGTTCCATTGGCTACTTTGCGAGC
TGGTGGTTCGTGAGGAAGATTTACTCCTCTATCAAGATTGATTAG
Gene >Ophcf2|02910
ATGCACCTCCGAACCGCCCTCGCGGCGGCGCTGGCGGCTTCGGCATCTGCCTTTTATCTCCCGGGAGTGGCGCCA
ACCTCCTACAAACCAGGTGATCGCGTTCCCCTCCAGGTCAACAGCATCCGGCCCGTCGCTGCGCCTCAAGATAAC
CGCCTGCATTCGGTCGTCTCTTACGACTATTACCATCCGGACTTTCACTTCTGCGAACCATCCGGCGGCCCGCAG
TATGTGCCCGAGAGCCTGGGGAGTATCCTCTCGGGTGACAGGCTGATGACGTCGCCCTTTGAGCTGCTCATGGCC
AAGAACGAAACCTGCAAGCCTCTATGCAAAGCATCCTACCCCGTCGAAAGCAAGAGGTTCGTCAACGAGCGGATA
GAGGAGGCCTATAGTCTCAACTGGCTCGTCGACGGCCTGCCTGCTGGACAGCAAATCAAAGACGACTTGACCGGC
ACAACCTTTTACAGCCCTGGCTTCCAGCTTGGCGGCTACTTCCTCTCGTCCGACGAGGAAGAGGAACTCTCCCTT
AATAACCATTACGAGATTTGGATCGAATACCATCCGGTCAATGGTCGGGAGAATGAGCTCCGTGTTGTCGGCGCC
GTCGTCCAGCCCAGCTCCAAGTTATACACGGGAGAGGTCGATTGCGCCGACGGCCACTCGCCCGTCTCTCTAACT
TCTGGCGATGAGGAGCAGCAGGTGCAGTTTAGCTACAGCGTCTACTGGCGCAAGTCGGAAACGGCCTGGGCCACG
CGCTGGGACAAGTATCTACACGTCTTCGACCCCAAGATCCACTGGTTCTGGCTCATTGACACGGCCGTCATTGTC
GTCATACTCGTCCTGACCGTCATGTCCGTGCTCGTCAGGACATTGAAAAAGGACATTGCACGGTACAATCGTCTG
GATCAGATCAGTCTCGATGACCTGAGCGGCACTTCGGTCGTCGAGGACGGTGTCCAAGAGGACTCGGGCTGGAAG
CTGATTCACGGCGACGTCTTTCGTACGCCGCCCCGACCCTTACTGCTGTCTGTGCTACTTGGCAACGGCGCCCAA
CTGTTTGTCATGACTGGCTTGACAATCGTCTTTGCCCTCCTCGGCTTTCTGTCACCTTCGAACCGTGGATCCCTG
GGAACCATCATGATCATCCTTTACACGCTTCTCGGTTCCGTTGGCGGTTACACCTCAGCCAGAACCTACAAGGCC
ATGTCTGGCGAACAATGGAAACTCAACATTGCCTTGACGCCGCTGCTGGTTCCCGGCATCGTCTTCTCTGCCTTC
TTTCTCCTCGACCTCTTCTTGTGGGCCAAGCGTTCGTCCGGTGCGGTACCCTTCACGACGATGCTCGTCATCATC
ATCATCTGGTTTGTCATATCCATACCGCTGTCCATTGTCGGATCGTGGATGGGCTTCCGTAGCCCTCAGATCGAG
GCGCCGGTGCGCACGAATCAGATTCCTCGTCAGATCCCGCCGGCCACCACATATCTCCAGCCGATCCCCAGCATG
CTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTCGTGGAGCTCTACTTCATCATGAGCTCCATCTGGTTCAGT
CGAATCTATTACATGTTTGGGTTCCTCTTTCTCTGCTACGGCCTGATGATTGTCGTCTGCGCCGCCGTCACCGTC
CTCATGACCTACTTCCTTCTTTGCGCCGAAAACTACAACTGGCAGTGGAGGTCGTTCCTCGCCGCTGGCATGAGC
GGCGGTTACATCTTCCTCAACTGCCTCCTCTATCTTCTCACCAAAGTGAAGCTCGGCGGGCTCGCTGGCATCGTC
CTTTACGTTGGCTACAGCGCGCTCATCTCCTTTTTGTTCTTCATTCTTGCCGGTACGTTGTCCCCTCCACGGACC
CCTCGGCGATTCTTGTCTAACGCACTTACAGGTTCCATTGGCTACTTTGCGAGCTGGTGGTTCGTGAGGAAGATT
TACTCCTCTATCAAGATTGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail