Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02900
Gene name
Locationscaffold_02:5067078..5067538
Strand-
Gene length (bp)460
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01176 eIF-1a Translation initiation factor 1A / IF-1 9.6E-16 25 90

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003743 translation initiation factor activity Yes
GO:0006413 translational initiation Yes
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0045182 translation regulator activity No
GO:0008135 translation factor activity, RNA binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4148 0.6841 0.0274 0.0229 0.1895 0.0142 0.0312 0.0193 0.0099 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5439
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1963
Ophiocordyceps australis map64 (Brazil) OphauB2|4609
Ophiocordyceps camponoti-floridani Ophcf2|02900 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5414
Ophiocordyceps kimflemingae Ophio5|5834
Ophiocordyceps subramaniannii Hirsu2|5988

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02900
MGRPKRSVLAAAEESLTPPESLLPNQFVARVIKPEGNNLYACELSCKKSIVLELAQRFRNTIWIKRGGFILAQFY
DVGNDDARPAGEIVNVVRDEKLWRKQPYWPKEFVKPTRYDAADGGDDSIVGKMPASDSEDE*
Coding >Ophcf2|02900
ATGGGCCGCCCGAAGCGAAGCGTCCTCGCGGCGGCAGAAGAGTCCCTGACGCCACCTGAGTCGCTGCTGCCCAAC
CAGTTCGTCGCCCGCGTGATCAAGCCCGAGGGCAACAACCTATACGCCTGCGAGCTCTCCTGCAAGAAGTCAATC
GTCTTGGAGCTCGCTCAGCGGTTCCGCAACACCATTTGGATCAAGCGCGGCGGCTTCATCCTTGCTCAATTCTAC
GACGTGGGCAATGATGATGCGCGGCCCGCTGGGGAGATTGTCAATGTTGTGCGCGACGAGAAGCTGTGGCGGAAG
CAGCCGTACTGGCCGAAGGAATTTGTCAAGCCCACGAGGTATGATGCAGCCGACGGCGGTGATGATTCCATTGTC
GGCAAGATGCCTGCTAGCGATTCGGAGGATGAGTGA
Transcript >Ophcf2|02900
ATGGGCCGCCCGAAGCGAAGCGTCCTCGCGGCGGCAGAAGAGTCCCTGACGCCACCTGAGTCGCTGCTGCCCAAC
CAGTTCGTCGCCCGCGTGATCAAGCCCGAGGGCAACAACCTATACGCCTGCGAGCTCTCCTGCAAGAAGTCAATC
GTCTTGGAGCTCGCTCAGCGGTTCCGCAACACCATTTGGATCAAGCGCGGCGGCTTCATCCTTGCTCAATTCTAC
GACGTGGGCAATGATGATGCGCGGCCCGCTGGGGAGATTGTCAATGTTGTGCGCGACGAGAAGCTGTGGCGGAAG
CAGCCGTACTGGCCGAAGGAATTTGTCAAGCCCACGAGGTATGATGCAGCCGACGGCGGTGATGATTCCATTGTC
GGCAAGATGCCTGCTAGCGATTCGGAGGATGAGTGA
Gene >Ophcf2|02900
ATGGGCCGCCCGAAGCGAAGCGTCCTCGCGGCGGCAGAAGAGTCCCTGACGCCACCTGAGTCGCTGCTGCCCAAC
CAGTTCGTCGCCCGCGTGATCAAGCCCGAGGGCAACAACCTATACGCCTGCGAGCTCTCCTGCAAGAAGTCAATC
GTCTTGGAGCTCGCTCAGCGGTTCCGCAACACCATTTGGATCAAGCGCGGCGGCTTCATCCTTGCTCAATTCTAC
GACGTGGGCAATGATGATGCGCGGCCCGCTGGGGAGATTGTCAATGTTGTGCGCGACGAGAAGCTGTGGCGGAAG
CAGCCGTACTGGTATGACTTCGTCCTGTTGATGAGACGCCCAGACGCTCAAGAGTTCAAGGCCGAAGGAATTTGT
CAAGCCCACGAGGTATGATGCAGCCGACGGCGGTGATGATTCCATTGTCGGCAAGATGCCTGCTAGCGATTCGGA
GGATGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail