Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02899
Gene name
Locationscaffold_02:5065668..5067067
Strand+
Gene length (bp)1399
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05208 ALG3 ALG3 protein 3.0E-144 30 393

GO

GO Term Description Terminal node
GO:0000030 mannosyltransferase activity Yes
GO:0016758 hexosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 103 125 22
3 146 168 22
4 183 205 22
5 212 234 22
6 268 290 22
7 353 375 22
8 390 412 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02899
MSSLQDKSLWRFTVDVAAGRHALSSIVAPALWLLDAVLCCLVIWGVPYTEIDWVAYMEQVAQFLSGERDYAKIEG
GTGPLVYPAAHVYIYSGLYHLTNRGENILLAQKLFAGLYLATLGLVMLCYRRAKAPPYLLVLLVLSKRLHSVFML
RCFNDCFAVFFLWLAIFLLQRRLWTLGALAYSLGLGVKMSLLLVLPAVAVVLFLGRGFGRSLHTAWLMALLQLAL
AVPFLAADWKSYLGRAFELSRQFKFEWTVNWRMVGEDRFLSKSFAITLLALHAAVLMLFIATRWIKHTGRRLSTM
IPALLRGRSPFTPPEELAVSRRVTPEYVITAVLSANVVGLLFARSLHYQFYAYLYWSSPYLLWIASPHPLLVVPA
WLAQEWAWNVFPSTTASSSVVVGVLAVTVGSVYLTTAKVDDSEERIKLSASKNE*
Coding >Ophcf2|02899
ATGTCGAGCCTCCAAGACAAAAGTCTGTGGCGCTTCACCGTCGATGTCGCCGCTGGCCGCCACGCCCTCTCGAGT
ATCGTCGCGCCCGCGCTCTGGCTGCTTGATGCGGTGCTGTGCTGCCTCGTCATCTGGGGGGTGCCTTATACAGAA
ATTGACTGGGTCGCGTACATGGAGCAGGTCGCCCAGTTCCTCTCCGGCGAGCGCGACTACGCGAAGATAGAGGGC
GGCACCGGCCCCCTCGTCTACCCAGCTGCACATGTCTACATCTATTCAGGTCTCTACCATCTGACGAATCGCGGA
GAGAATATCCTGCTTGCTCAGAAGCTCTTTGCCGGTCTCTATCTGGCTACGCTCGGCCTCGTAATGCTGTGCTAT
CGGCGCGCCAAGGCACCGCCGTACCTGCTCGTACTTCTGGTTCTTTCGAAGCGCCTTCACAGCGTATTCATGTTG
CGTTGCTTCAACGACTGCTTCGCCGTCTTTTTCCTCTGGCTCGCCATCTTTCTGCTTCAGCGGAGGTTATGGACC
CTCGGCGCCTTGGCTTACAGTTTGGGGCTCGGCGTCAAAATGTCGCTGCTACTGGTTCTCCCGGCTGTGGCAGTT
GTGCTCTTCCTCGGGCGGGGCTTTGGCCGAAGCCTGCACACGGCCTGGCTGATGGCGCTCTTGCAGCTCGCTCTA
GCTGTGCCATTCCTCGCCGCGGACTGGAAGTCATATTTGGGAAGAGCATTTGAGCTGTCACGGCAGTTCAAGTTC
GAGTGGACGGTTAATTGGCGAATGGTGGGGGAGGACAGGTTCCTCAGCAAGTCCTTTGCTATAACGCTGCTCGCT
CTTCATGCGGCAGTTTTGATGCTCTTTATCGCGACAAGATGGATAAAGCATACAGGTCGGCGTCTGTCGACCATG
ATCCCTGCCCTGCTCCGCGGCCGATCCCCCTTCACACCGCCTGAGGAGCTCGCCGTGTCCAGACGCGTCACGCCC
GAATACGTCATAACGGCTGTGCTATCGGCCAACGTTGTCGGATTGCTGTTCGCCCGCTCCCTTCACTACCAGTTC
TACGCCTACCTGTACTGGTCCTCGCCGTACTTACTGTGGATAGCCTCACCTCATCCGCTCCTCGTCGTGCCTGCG
TGGCTGGCACAAGAATGGGCCTGGAACGTCTTCCCGAGCACCACTGCCAGCTCGTCTGTCGTGGTCGGCGTTCTC
GCCGTCACGGTGGGCTCGGTTTATTTGACAACCGCGAAAGTGGATGATTCGGAAGAGCGGATAAAGCTGAGTGCG
AGCAAGAACGAGTAA
Transcript >Ophcf2|02899
ATGTCGAGCCTCCAAGACAAAAGTCTGTGGCGCTTCACCGTCGATGTCGCCGCTGGCCGCCACGCCCTCTCGAGT
ATCGTCGCGCCCGCGCTCTGGCTGCTTGATGCGGTGCTGTGCTGCCTCGTCATCTGGGGGGTGCCTTATACAGAA
ATTGACTGGGTCGCGTACATGGAGCAGGTCGCCCAGTTCCTCTCCGGCGAGCGCGACTACGCGAAGATAGAGGGC
GGCACCGGCCCCCTCGTCTACCCAGCTGCACATGTCTACATCTATTCAGGTCTCTACCATCTGACGAATCGCGGA
GAGAATATCCTGCTTGCTCAGAAGCTCTTTGCCGGTCTCTATCTGGCTACGCTCGGCCTCGTAATGCTGTGCTAT
CGGCGCGCCAAGGCACCGCCGTACCTGCTCGTACTTCTGGTTCTTTCGAAGCGCCTTCACAGCGTATTCATGTTG
CGTTGCTTCAACGACTGCTTCGCCGTCTTTTTCCTCTGGCTCGCCATCTTTCTGCTTCAGCGGAGGTTATGGACC
CTCGGCGCCTTGGCTTACAGTTTGGGGCTCGGCGTCAAAATGTCGCTGCTACTGGTTCTCCCGGCTGTGGCAGTT
GTGCTCTTCCTCGGGCGGGGCTTTGGCCGAAGCCTGCACACGGCCTGGCTGATGGCGCTCTTGCAGCTCGCTCTA
GCTGTGCCATTCCTCGCCGCGGACTGGAAGTCATATTTGGGAAGAGCATTTGAGCTGTCACGGCAGTTCAAGTTC
GAGTGGACGGTTAATTGGCGAATGGTGGGGGAGGACAGGTTCCTCAGCAAGTCCTTTGCTATAACGCTGCTCGCT
CTTCATGCGGCAGTTTTGATGCTCTTTATCGCGACAAGATGGATAAAGCATACAGGTCGGCGTCTGTCGACCATG
ATCCCTGCCCTGCTCCGCGGCCGATCCCCCTTCACACCGCCTGAGGAGCTCGCCGTGTCCAGACGCGTCACGCCC
GAATACGTCATAACGGCTGTGCTATCGGCCAACGTTGTCGGATTGCTGTTCGCCCGCTCCCTTCACTACCAGTTC
TACGCCTACCTGTACTGGTCCTCGCCGTACTTACTGTGGATAGCCTCACCTCATCCGCTCCTCGTCGTGCCTGCG
TGGCTGGCACAAGAATGGGCCTGGAACGTCTTCCCGAGCACCACTGCCAGCTCGTCTGTCGTGGTCGGCGTTCTC
GCCGTCACGGTGGGCTCGGTTTATTTGACAACCGCGAAAGTGGATGATTCGGAAGAGCGGATAAAGCTGAGTGCG
AGCAAGAACGAGTAA
Gene >Ophcf2|02899
ATGTCGAGCCTCCAAGACAAAAGTCTGTGGCGCTTCACCGTCGATGTCGCCGCTGGCCGCCACGCCCTCTCGAGT
ATCGTCGCGCCCGCGCTCTGGCTGCTTGATGCGGTGCTGTGCTGCCTCGTCATCTGGGGGGTGCCTTGTCCGTCT
CCCGCCAATATGTGCTCTCGAACAATATCTGACGACGCGGCTGCAGATACAGAAATTGACTGGGTCGCGTACATG
GAGCAGGTCGCCCAGTTCCTCTCCGGCGAGCGCGACTACGCGAAGATAGAGGGCGGCACCGGCCCCCTCGTCTAC
CCAGCTGCACATGTCTACATCTATTCAGGTCTCTACCATCTGACGAATCGCGGAGAGAATATCCTGCTTGCTCAG
AAGCTCTTTGCCGGTCTCTATCTGGCTACGCTCGGCCTCGTAATGCTGTGCTATCGGCGCGCCAAGGTAGGCCGG
CATTCGAGCACGCTGGTGGACAGGCTGCTCTAATATCGAGCCACAGGCACCGCCGTACCTGCTCGTACTTCTGGT
TCTTTCGAAGCGCCTTCACAGCGTATTCATGTTGCGTTGCTTCAACGACTGCTTCGCCGTCTTTTTCCTCTGGCT
CGCCATCTTTCTGCTTCAGCGGAGGTTATGGACCCTCGGCGCCTTGGCTTACAGTTTGGGGCTCGGCGTCAAAAT
GTCGCTGCTACTGGTTCTCCCGGCTGTGGCAGTTGTGCTCTTCCTCGGGCGGGGCTTTGGCCGAAGCCTGCACAC
GGCCTGGCTGATGGCGCTCTTGCAGCTCGCTCTAGCTGTGCCATTCCTCGCCGCGGACTGGAAGTCATATTTGGG
AAGAGCATTTGAGCTGTCACGGCAGTTCAAGTTCGAGTGGACGGTTAATTGGCGAATGGTGGGGGAGGACAGGTT
CCTCAGCAAGTCCTTTGCTATAACGCTGCTCGCTCTTCATGCGGCAGTTTTGATGCTCTTTATCGCGACAAGATG
GATAAAGCATACAGGTCGGCGTCTGTCGACCATGATCCCTGCCCTGCTCCGCGGCCGATCCCCCTTCACACCGCC
TGAGGAGCTCGCCGTGTCCAGACGCGTCACGCCCGAATACGTCATAACGGCTGTGCTATCGGCCAACGTTGTCGG
ATTGCTGTTCGCCCGCTCCCTTCACTACCAGTTCTACGCCTACCTGTACTGGTCCTCGCCGTACTTACTGTGGAT
AGCCTCACCTCATCCGCTCCTCGTCGTGCCTGCGTGGCTGGCACAAGAATGGGCCTGGAACGTCTTCCCGAGCAC
CACTGCCAGCTCGTCTGTCGTGGTCGGCGTTCTCGCCGTCACGGTGGGCTCGGTTTATTTGACAACCGCGAAAGT
GGATGATTCGGAAGAGCGGATAAAGCTGAGTGCGAGCAAGAACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail