Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02898
Gene name
Locationscaffold_02:5064136..5065428
Strand+
Gene length (bp)1292
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 3.5E-36 5 347

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.3212 0.3005 0.056 0.0116 0.5762 0.0287 0.2805 0.0472 0.1833 0.7556

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6196
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4607
Ophiocordyceps camponoti-floridani Ophcf2|02898 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5412
Ophiocordyceps kimflemingae Ophio5|5836
Ophiocordyceps subramaniannii Hirsu2|5990

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02898
MPTTIVVVGAGVSGLTSALLLSKTKANAVTIVAKHMPGDYHIEYASPWAGANVLPMANLENSRWERRTWPELKRL
AEQVPEAGIHFQSCRVYRRDKDLQQESVLSDSLFDRNPWYASMLPNYRELRPDEVVSGHDSGCEFTSVCINTATY
LQWLLGQCLRNGVVVRRAILSDISEARALSHTGEAASIVVNSTGLGSRYLSGVRDATMLPVRGQTVLVRNECHPM
ITTSGTDDGDVEIIYLMQRAGGGGTIIGGTFDPDNWNAEPDPNLAIRIMKRALDVCPTLAGGKGIDGLSIIRHGV
GLRPYRKGGVRIETEVKADGFSIVHNYGHSSWGYQGSYGCAEKVVELVNEIRGKKIEDLSKEIQLLPTR*
Coding >Ophcf2|02898
ATGCCCACTACTATTGTTGTCGTCGGGGCCGGCGTCAGCGGCCTGACGTCGGCGCTGTTGCTGTCCAAGACCAAG
GCCAACGCCGTCACCATCGTCGCGAAGCACATGCCCGGCGACTATCACATCGAGTACGCGTCGCCATGGGCCGGT
GCGAACGTCTTGCCCATGGCAAACCTCGAGAATAGCAGGTGGGAGCGGCGGACTTGGCCAGAGCTGAAGCGGCTG
GCAGAGCAGGTCCCCGAAGCTGGCATTCATTTTCAGAGCTGCCGCGTGTACCGGCGCGACAAGGACTTGCAGCAG
GAGAGCGTCCTGAGCGACTCGCTCTTCGATCGTAACCCGTGGTACGCGTCGATGCTGCCCAACTATCGTGAGTTG
CGTCCGGACGAGGTAGTGTCAGGGCACGATTCTGGCTGCGAGTTCACCAGTGTTTGCATCAACACGGCCACTTAC
CTGCAGTGGCTTCTCGGCCAGTGCCTGAGAAACGGCGTCGTCGTCCGGCGTGCCATCCTGTCTGACATCTCCGAG
GCTCGAGCCCTGAGCCACACCGGAGAGGCGGCCTCTATCGTCGTCAACTCCACGGGCCTGGGCTCGCGGTATCTG
AGCGGCGTGCGCGACGCGACGATGCTGCCTGTGCGGGGCCAGACGGTCCTGGTGCGCAACGAGTGCCATCCCATG
ATCACCACGTCCGGAACCGACGACGGTGATGTCGAGATCATTTACCTCATGCAGCGAGCCGGCGGAGGGGGCACC
ATCATTGGAGGCACCTTTGACCCCGACAACTGGAACGCCGAGCCGGATCCGAACCTCGCCATCCGCATCATGAAG
CGCGCTCTCGACGTCTGCCCGACCCTCGCAGGCGGCAAGGGCATCGATGGTCTGAGCATCATCAGACACGGCGTC
GGCTTGCGTCCATATCGCAAGGGCGGCGTGAGAATCGAAACCGAAGTCAAGGCCGACGGTTTCAGCATCGTCCAC
AACTATGGGCACTCCAGCTGGGGATATCAGGGTTCGTATGGTTGTGCCGAGAAGGTCGTTGAGCTGGTCAACGAG
ATCCGCGGCAAGAAGATCGAGGACCTCAGCAAGGAGATCCAGCTGTTGCCGACCCGATAG
Transcript >Ophcf2|02898
ATGCCCACTACTATTGTTGTCGTCGGGGCCGGCGTCAGCGGCCTGACGTCGGCGCTGTTGCTGTCCAAGACCAAG
GCCAACGCCGTCACCATCGTCGCGAAGCACATGCCCGGCGACTATCACATCGAGTACGCGTCGCCATGGGCCGGT
GCGAACGTCTTGCCCATGGCAAACCTCGAGAATAGCAGGTGGGAGCGGCGGACTTGGCCAGAGCTGAAGCGGCTG
GCAGAGCAGGTCCCCGAAGCTGGCATTCATTTTCAGAGCTGCCGCGTGTACCGGCGCGACAAGGACTTGCAGCAG
GAGAGCGTCCTGAGCGACTCGCTCTTCGATCGTAACCCGTGGTACGCGTCGATGCTGCCCAACTATCGTGAGTTG
CGTCCGGACGAGGTAGTGTCAGGGCACGATTCTGGCTGCGAGTTCACCAGTGTTTGCATCAACACGGCCACTTAC
CTGCAGTGGCTTCTCGGCCAGTGCCTGAGAAACGGCGTCGTCGTCCGGCGTGCCATCCTGTCTGACATCTCCGAG
GCTCGAGCCCTGAGCCACACCGGAGAGGCGGCCTCTATCGTCGTCAACTCCACGGGCCTGGGCTCGCGGTATCTG
AGCGGCGTGCGCGACGCGACGATGCTGCCTGTGCGGGGCCAGACGGTCCTGGTGCGCAACGAGTGCCATCCCATG
ATCACCACGTCCGGAACCGACGACGGTGATGTCGAGATCATTTACCTCATGCAGCGAGCCGGCGGAGGGGGCACC
ATCATTGGAGGCACCTTTGACCCCGACAACTGGAACGCCGAGCCGGATCCGAACCTCGCCATCCGCATCATGAAG
CGCGCTCTCGACGTCTGCCCGACCCTCGCAGGCGGCAAGGGCATCGATGGTCTGAGCATCATCAGACACGGCGTC
GGCTTGCGTCCATATCGCAAGGGCGGCGTGAGAATCGAAACCGAAGTCAAGGCCGACGGTTTCAGCATCGTCCAC
AACTATGGGCACTCCAGCTGGGGATATCAGGGTTCGTATGGTTGTGCCGAGAAGGTCGTTGAGCTGGTCAACGAG
ATCCGCGGCAAGAAGATCGAGGACCTCAGCAAGGAGATCCAGCTGTTGCCGACCCGATAG
Gene >Ophcf2|02898
ATGCCCACTACTATTGTTGTCGTCGGGTGAGTCGTCCAGCTCGTCAAGCGCTCTGCCCGGGCCGTCTGATGTATT
GTCCAGGGCCGGCGTCAGCGGCCTGACGTCGGCGCTGTTGCTGTCCAAGACCAAGGCCAACGCCGTCACCATCGT
CGCGAAGCACATGCCCGGCGACTATCACATCGAGTACGCGTCGCCATGGGCCGGTGCGAACGTCTTGCCGTGCGT
GGGAAGCCCCCCCCCCTTATCGCCCGCATGCGAAGATGGCGGCTGAAAGAGGCTTTGCGCGCACAGCATGGCAAA
CCTCGAGAATAGCAGGTGGGAGCGGCGGACTTGGCCAGAGCTGAAGCGGCTGGCAGAGCAGGTCCCCGAAGCTGG
CATTCATTTTCAGAGCAAGCCTCGCTGTTGTCTTCGACTTTGTTGGCCAGGCAAACTGACAAGAGGTAGGCTGCC
GCGTGTACCGGCGCGACAAGGACTTGCAGCAGGAGAGCGTCCTGAGCGACTCGCTCTTCGATCGTAACCCGTGGT
ACGCGTCGATGCTGCCCAACTATCGTGAGTTGCGTCCGGACGAGGTAGTGTCAGGGCACGATTCTGGCTGCGAGT
TCACCAGTGTTTGCATCAACACGGCCACTTACCTGCAGTGGCTTCTCGGCCAGTGCCTGAGAAACGGCGTCGTCG
TCCGGCGTGCCATCCTGTCTGACATCTCCGAGGCTCGAGCCCTGAGCCACACCGGAGAGGCGGCCTCTATCGTCG
TCAACTCCACGGGCCTGGGCTCGCGGTATCTGAGCGGCGTGCGCGACGCGACGATGCTGCCTGTGCGGGGCCAGA
CGGTCCTGGTGCGCAACGAGTGCCATCCCATGATCACCACGTCCGGAACCGACGACGGTGATGTCGAGATCATTT
ACCTCATGCAGCGAGCCGGCGGAGGGGGCACCATCATTGGAGGCACCTTTGACCCCGACAACTGGAACGCCGAGC
CGGATCCGAACCTCGCCATCCGCATCATGAAGCGCGCTCTCGACGTCTGCCCGACCCTCGCAGGCGGCAAGGGCA
TCGATGGTCTGAGCATCATCAGACACGGCGTCGGCTTGCGTCCATATCGCAAGGGCGGCGTGAGAATCGAAACCG
AAGTCAAGGCCGACGGTTTCAGCATCGTCCACAACTATGGGCACTCCAGCTGGGGATATCAGGGTTCGTATGGTT
GTGCCGAGAAGGTCGTTGAGCTGGTCAACGAGATCCGCGGCAAGAAGATCGAGGACCTCAGCAAGGAGATCCAGC
TGTTGCCGACCCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail