Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02887
Gene name
Locationscaffold_02:5033167..5036200
Strand-
Gene length (bp)3033
Transcript length (bp)3033
Coding sequence length (bp)3033
Protein length (aa) 1011

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.9E-09 543 633
PF00023 Ank Ankyrin repeat 4.1E-03 604 633

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6374 0.3644 0.1425 0.2464 0.1691 0.0321 0.1083 0.3276 0.2031 0.0702

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 363.91 148.75 579.07
Alive In ants, during behavior modification 67.06 30.62 103.50
Dead In ants, recently dead 38.93 21.50 56.37

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.002959 yes
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup3725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6726
Ophiocordyceps australis map64 (Brazil) OphauB2|4627
Ophiocordyceps camponoti-floridani Ophcf2|02887 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1811
Ophiocordyceps kimflemingae Ophio5|5707
Ophiocordyceps subramaniannii Hirsu2|7269

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02887
MLKDAPFVSPCRESVASNLNGAVGPSTSQHRVSLFPPRTDVSSTPRSSPSDPALASAALPSSVLAAGRSSSPLSA
GTIRSSSTARPSSVSTTRSRHHHQPLGSSGHRRNGNMATCGKAQAQCLELCHNIASAGDGVAERMAEYMTVVKHV
PFGFNGLANELLDVCHVLFYIEAGLEEAVGNAHPLPLEMITVLEKRFRAAQADFKSLDHTVGKWLDNERRGAVGR
MRRGFGKVFGKDGIDKMLLALQRHRTELKMSALMFQWNLGSDRIESDPGIGYVALNATLEDSNIRRKHESMAFAN
AADDRPSSASSSMHHSKNSSSRQRKVNSVIHDSKPQTRESKVIPFSPDSTSGESGSSTAPSFEFGHGTPSTHLTA
SHSASHDRSDGLDEVPELSLELETLVADVVGPILDSSVVETREHEASAMPRRRSRSSTESDKVSSKHALVSAIRV
KDHRLVSQLLDRGVSPNTGPDAHAVNESIAIQDVESLRLLLLYGADPDALDRDGLSPLGAAVRGSLLSAAALLLK
YGADVDMEPTLGMERPLAVAVASSNPRMTRLLLMYGAGPNQPTAEGDTLLICGIGKKTPKRLIESLLMYGSNAND
KNRDGKTALFEAIQNARADIATLLLDKGADPNLPGPKHMLWPAAYQPPCLEVLLAYGADYKKCPGIMELATSINR
VESVQMLLNAGVDPNSKKDGVYTPLCTSIRDNRGDIFQLLLAKGADPNLRASEYPAFKCVTHHREHFLPALVAAG
ARLNTPKGILETAVSSNNGQALGWLLDQGLDPDDKNAKGHTALTSAIRDDRADFVDTLLAHGANPNIRGQDWPLC
MAVKHPGILKRILETLPEPRAFKGVVEMAVVANQLESIKLLLAAGVSVEDRNGGVFSPLTTALRERRREIVQFLI
EEGGADVNAPGEHLPIVKALRRCQEEEHQDMIEMLLNKGADPNKVYRGWNGVMQALENGDAAMLERLCAKSGVDL
DVKDELGRNVTEIAVSRRWEEAVNILLGNAIKTTS*
Coding >Ophcf2|02887
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTGAACGGTGCCGTTGGTCCG
TCGACTTCGCAACATCGAGTCTCTCTGTTCCCGCCCCGAACTGACGTCTCGTCGACGCCGCGATCTTCACCTTCC
GACCCTGCCCTTGCCTCCGCCGCTCTACCGTCCTCTGTTCTCGCGGCCGGACGCTCGTCGTCGCCATTGTCCGCA
GGGACTATACGGTCGTCCTCAACGGCCCGGCCCTCTTCGGTTTCCACCACCCGATCCCGACATCACCACCAGCCG
CTGGGCTCTTCGGGCCACCGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCACAGTGCCTCGAGCTA
TGTCACAACATCGCCAGCGCCGGTGATGGCGTCGCCGAGCGCATGGCCGAGTACATGACCGTCGTCAAGCACGTT
CCCTTTGGATTCAACGGTCTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTT
GAAGAAGCCGTTGGCAATGCTCACCCGCTGCCTCTCGAGATGATCACCGTGCTGGAGAAGAGGTTCCGCGCGGCC
CAGGCCGACTTCAAGTCTCTGGATCACACCGTCGGCAAGTGGCTTGACAATGAGCGTCGCGGTGCAGTCGGCCGC
ATGCGTCGCGGCTTCGGCAAGGTCTTTGGGAAGGATGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCACCGC
ACCGAGCTCAAGATGAGCGCCCTCATGTTCCAGTGGAATCTCGGGTCCGACAGGATCGAAAGCGACCCTGGCATC
GGCTACGTCGCGCTCAACGCCACTCTGGAAGACAGCAACATCCGCCGCAAACATGAATCAATGGCCTTTGCCAAC
GCGGCCGATGATAGGCCGTCGTCGGCGTCATCATCGATGCATCACTCCAAAAATTCGTCGTCGCGGCAGAGAAAA
GTCAACTCGGTGATTCACGACTCCAAGCCGCAGACCAGGGAATCCAAGGTGATCCCCTTCAGCCCGGACTCGACG
AGCGGCGAAAGCGGCAGCTCCACGGCTCCCTCGTTCGAGTTCGGTCACGGTACTCCATCCACCCACCTCACCGCG
AGCCACTCGGCCTCACATGACCGTTCAGACGGCCTCGACGAGGTACCCGAGCTGAGCCTCGAGCTCGAGACGCTC
GTCGCCGACGTCGTTGGCCCCATCTTGGATAGTTCCGTCGTGGAGACGCGCGAGCACGAGGCCTCGGCCATGCCC
AGACGTCGGTCCCGCAGCAGCACCGAGAGCGACAAGGTCAGCTCCAAGCACGCCCTCGTCTCTGCCATCCGCGTC
AAGGACCACAGGCTCGTCTCGCAGCTCCTCGACCGCGGCGTGTCGCCCAACACGGGTCCGGATGCGCACGCCGTC
AACGAATCCATCGCGATTCAAGACGTCGAGAGTCTGCGGCTCCTGCTCCTGTACGGCGCCGACCCGGACGCGCTC
GACAGGGACGGACTGAGCCCCCTCGGAGCCGCCGTCCGCGGCTCCCTCCTCTCCGCCGCGGCCCTGCTCCTCAAG
TACGGCGCCGACGTCGACATGGAGCCGACTCTGGGGATGGAGAGGCCGCTGGCCGTGGCAGTGGCCAGCAGTAAC
CCCCGGATGACGCGTCTCTTGCTGATGTACGGCGCCGGACCCAACCAGCCGACGGCCGAGGGCGACACGCTCCTC
ATCTGCGGCATCGGCAAGAAGACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGCCAACGAC
AAGAACCGCGACGGCAAGACGGCCCTGTTCGAGGCCATTCAGAACGCGAGAGCCGACATCGCCACGCTGCTGCTG
GACAAGGGCGCGGACCCGAACCTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTATCAGCCTCCCTGCCTC
GAGGTTCTCCTCGCATACGGGGCCGACTACAAGAAGTGCCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGG
GTTGAGTCGGTGCAGATGCTGCTGAACGCGGGCGTCGATCCCAACTCCAAAAAGGACGGCGTCTATACGCCGCTT
TGCACTTCGATCCGCGATAACCGCGGCGACATCTTCCAGCTGCTGCTGGCCAAGGGGGCGGACCCAAACCTGAGG
GCCAGCGAGTACCCGGCATTCAAGTGCGTCACGCACCACCGCGAGCACTTCCTCCCGGCGCTGGTGGCGGCCGGG
GCGCGGCTCAACACGCCCAAGGGCATCCTGGAGACGGCTGTGTCGTCCAATAACGGCCAGGCGCTGGGCTGGCTG
CTGGATCAGGGCCTGGATCCCGATGACAAGAATGCCAAGGGTCACACGGCACTGACGAGCGCCATTCGCGACGAT
CGCGCCGATTTCGTCGACACACTACTGGCGCACGGGGCCAACCCCAATATCCGCGGCCAGGACTGGCCCTTGTGC
ATGGCGGTCAAGCACCCGGGAATTCTCAAGCGTATACTGGAGACGCTGCCCGAGCCGCGAGCCTTCAAGGGCGTG
GTGGAGATGGCCGTGGTGGCCAACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTATCGGTCGAGGAT
CGCAATGGTGGCGTCTTCTCGCCCCTGACGACGGCCCTGCGCGAGCGGCGACGTGAGATCGTGCAGTTCCTGATT
GAAGAGGGCGGCGCCGACGTCAACGCCCCTGGCGAGCATCTTCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAA
GAGGAGCACCAGGATATGATTGAGATGCTGCTGAACAAGGGCGCTGATCCGAACAAGGTGTACCGCGGATGGAAC
GGCGTGATGCAGGCGCTGGAGAATGGCGACGCGGCGATGCTGGAGAGGCTGTGTGCCAAGTCCGGAGTCGATCTG
GACGTCAAGGATGAGCTGGGCCGCAACGTGACGGAGATTGCCGTGTCGAGGCGGTGGGAGGAGGCTGTGAATATC
CTGTTGGGCAACGCCATCAAGACGACGTCGTAG
Transcript >Ophcf2|02887
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTGAACGGTGCCGTTGGTCCG
TCGACTTCGCAACATCGAGTCTCTCTGTTCCCGCCCCGAACTGACGTCTCGTCGACGCCGCGATCTTCACCTTCC
GACCCTGCCCTTGCCTCCGCCGCTCTACCGTCCTCTGTTCTCGCGGCCGGACGCTCGTCGTCGCCATTGTCCGCA
GGGACTATACGGTCGTCCTCAACGGCCCGGCCCTCTTCGGTTTCCACCACCCGATCCCGACATCACCACCAGCCG
CTGGGCTCTTCGGGCCACCGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCACAGTGCCTCGAGCTA
TGTCACAACATCGCCAGCGCCGGTGATGGCGTCGCCGAGCGCATGGCCGAGTACATGACCGTCGTCAAGCACGTT
CCCTTTGGATTCAACGGTCTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTT
GAAGAAGCCGTTGGCAATGCTCACCCGCTGCCTCTCGAGATGATCACCGTGCTGGAGAAGAGGTTCCGCGCGGCC
CAGGCCGACTTCAAGTCTCTGGATCACACCGTCGGCAAGTGGCTTGACAATGAGCGTCGCGGTGCAGTCGGCCGC
ATGCGTCGCGGCTTCGGCAAGGTCTTTGGGAAGGATGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCACCGC
ACCGAGCTCAAGATGAGCGCCCTCATGTTCCAGTGGAATCTCGGGTCCGACAGGATCGAAAGCGACCCTGGCATC
GGCTACGTCGCGCTCAACGCCACTCTGGAAGACAGCAACATCCGCCGCAAACATGAATCAATGGCCTTTGCCAAC
GCGGCCGATGATAGGCCGTCGTCGGCGTCATCATCGATGCATCACTCCAAAAATTCGTCGTCGCGGCAGAGAAAA
GTCAACTCGGTGATTCACGACTCCAAGCCGCAGACCAGGGAATCCAAGGTGATCCCCTTCAGCCCGGACTCGACG
AGCGGCGAAAGCGGCAGCTCCACGGCTCCCTCGTTCGAGTTCGGTCACGGTACTCCATCCACCCACCTCACCGCG
AGCCACTCGGCCTCACATGACCGTTCAGACGGCCTCGACGAGGTACCCGAGCTGAGCCTCGAGCTCGAGACGCTC
GTCGCCGACGTCGTTGGCCCCATCTTGGATAGTTCCGTCGTGGAGACGCGCGAGCACGAGGCCTCGGCCATGCCC
AGACGTCGGTCCCGCAGCAGCACCGAGAGCGACAAGGTCAGCTCCAAGCACGCCCTCGTCTCTGCCATCCGCGTC
AAGGACCACAGGCTCGTCTCGCAGCTCCTCGACCGCGGCGTGTCGCCCAACACGGGTCCGGATGCGCACGCCGTC
AACGAATCCATCGCGATTCAAGACGTCGAGAGTCTGCGGCTCCTGCTCCTGTACGGCGCCGACCCGGACGCGCTC
GACAGGGACGGACTGAGCCCCCTCGGAGCCGCCGTCCGCGGCTCCCTCCTCTCCGCCGCGGCCCTGCTCCTCAAG
TACGGCGCCGACGTCGACATGGAGCCGACTCTGGGGATGGAGAGGCCGCTGGCCGTGGCAGTGGCCAGCAGTAAC
CCCCGGATGACGCGTCTCTTGCTGATGTACGGCGCCGGACCCAACCAGCCGACGGCCGAGGGCGACACGCTCCTC
ATCTGCGGCATCGGCAAGAAGACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGCCAACGAC
AAGAACCGCGACGGCAAGACGGCCCTGTTCGAGGCCATTCAGAACGCGAGAGCCGACATCGCCACGCTGCTGCTG
GACAAGGGCGCGGACCCGAACCTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTATCAGCCTCCCTGCCTC
GAGGTTCTCCTCGCATACGGGGCCGACTACAAGAAGTGCCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGG
GTTGAGTCGGTGCAGATGCTGCTGAACGCGGGCGTCGATCCCAACTCCAAAAAGGACGGCGTCTATACGCCGCTT
TGCACTTCGATCCGCGATAACCGCGGCGACATCTTCCAGCTGCTGCTGGCCAAGGGGGCGGACCCAAACCTGAGG
GCCAGCGAGTACCCGGCATTCAAGTGCGTCACGCACCACCGCGAGCACTTCCTCCCGGCGCTGGTGGCGGCCGGG
GCGCGGCTCAACACGCCCAAGGGCATCCTGGAGACGGCTGTGTCGTCCAATAACGGCCAGGCGCTGGGCTGGCTG
CTGGATCAGGGCCTGGATCCCGATGACAAGAATGCCAAGGGTCACACGGCACTGACGAGCGCCATTCGCGACGAT
CGCGCCGATTTCGTCGACACACTACTGGCGCACGGGGCCAACCCCAATATCCGCGGCCAGGACTGGCCCTTGTGC
ATGGCGGTCAAGCACCCGGGAATTCTCAAGCGTATACTGGAGACGCTGCCCGAGCCGCGAGCCTTCAAGGGCGTG
GTGGAGATGGCCGTGGTGGCCAACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTATCGGTCGAGGAT
CGCAATGGTGGCGTCTTCTCGCCCCTGACGACGGCCCTGCGCGAGCGGCGACGTGAGATCGTGCAGTTCCTGATT
GAAGAGGGCGGCGCCGACGTCAACGCCCCTGGCGAGCATCTTCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAA
GAGGAGCACCAGGATATGATTGAGATGCTGCTGAACAAGGGCGCTGATCCGAACAAGGTGTACCGCGGATGGAAC
GGCGTGATGCAGGCGCTGGAGAATGGCGACGCGGCGATGCTGGAGAGGCTGTGTGCCAAGTCCGGAGTCGATCTG
GACGTCAAGGATGAGCTGGGCCGCAACGTGACGGAGATTGCCGTGTCGAGGCGGTGGGAGGAGGCTGTGAATATC
CTGTTGGGCAACGCCATCAAGACGACGTCGTAG
Gene >Ophcf2|02887
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTGAACGGTGCCGTTGGTCCG
TCGACTTCGCAACATCGAGTCTCTCTGTTCCCGCCCCGAACTGACGTCTCGTCGACGCCGCGATCTTCACCTTCC
GACCCTGCCCTTGCCTCCGCCGCTCTACCGTCCTCTGTTCTCGCGGCCGGACGCTCGTCGTCGCCATTGTCCGCA
GGGACTATACGGTCGTCCTCAACGGCCCGGCCCTCTTCGGTTTCCACCACCCGATCCCGACATCACCACCAGCCG
CTGGGCTCTTCGGGCCACCGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCACAGTGCCTCGAGCTA
TGTCACAACATCGCCAGCGCCGGTGATGGCGTCGCCGAGCGCATGGCCGAGTACATGACCGTCGTCAAGCACGTT
CCCTTTGGATTCAACGGTCTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTT
GAAGAAGCCGTTGGCAATGCTCACCCGCTGCCTCTCGAGATGATCACCGTGCTGGAGAAGAGGTTCCGCGCGGCC
CAGGCCGACTTCAAGTCTCTGGATCACACCGTCGGCAAGTGGCTTGACAATGAGCGTCGCGGTGCAGTCGGCCGC
ATGCGTCGCGGCTTCGGCAAGGTCTTTGGGAAGGATGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCACCGC
ACCGAGCTCAAGATGAGCGCCCTCATGTTCCAGTGGAATCTCGGGTCCGACAGGATCGAAAGCGACCCTGGCATC
GGCTACGTCGCGCTCAACGCCACTCTGGAAGACAGCAACATCCGCCGCAAACATGAATCAATGGCCTTTGCCAAC
GCGGCCGATGATAGGCCGTCGTCGGCGTCATCATCGATGCATCACTCCAAAAATTCGTCGTCGCGGCAGAGAAAA
GTCAACTCGGTGATTCACGACTCCAAGCCGCAGACCAGGGAATCCAAGGTGATCCCCTTCAGCCCGGACTCGACG
AGCGGCGAAAGCGGCAGCTCCACGGCTCCCTCGTTCGAGTTCGGTCACGGTACTCCATCCACCCACCTCACCGCG
AGCCACTCGGCCTCACATGACCGTTCAGACGGCCTCGACGAGGTACCCGAGCTGAGCCTCGAGCTCGAGACGCTC
GTCGCCGACGTCGTTGGCCCCATCTTGGATAGTTCCGTCGTGGAGACGCGCGAGCACGAGGCCTCGGCCATGCCC
AGACGTCGGTCCCGCAGCAGCACCGAGAGCGACAAGGTCAGCTCCAAGCACGCCCTCGTCTCTGCCATCCGCGTC
AAGGACCACAGGCTCGTCTCGCAGCTCCTCGACCGCGGCGTGTCGCCCAACACGGGTCCGGATGCGCACGCCGTC
AACGAATCCATCGCGATTCAAGACGTCGAGAGTCTGCGGCTCCTGCTCCTGTACGGCGCCGACCCGGACGCGCTC
GACAGGGACGGACTGAGCCCCCTCGGAGCCGCCGTCCGCGGCTCCCTCCTCTCCGCCGCGGCCCTGCTCCTCAAG
TACGGCGCCGACGTCGACATGGAGCCGACTCTGGGGATGGAGAGGCCGCTGGCCGTGGCAGTGGCCAGCAGTAAC
CCCCGGATGACGCGTCTCTTGCTGATGTACGGCGCCGGACCCAACCAGCCGACGGCCGAGGGCGACACGCTCCTC
ATCTGCGGCATCGGCAAGAAGACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGCCAACGAC
AAGAACCGCGACGGCAAGACGGCCCTGTTCGAGGCCATTCAGAACGCGAGAGCCGACATCGCCACGCTGCTGCTG
GACAAGGGCGCGGACCCGAACCTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTATCAGCCTCCCTGCCTC
GAGGTTCTCCTCGCATACGGGGCCGACTACAAGAAGTGCCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGG
GTTGAGTCGGTGCAGATGCTGCTGAACGCGGGCGTCGATCCCAACTCCAAAAAGGACGGCGTCTATACGCCGCTT
TGCACTTCGATCCGCGATAACCGCGGCGACATCTTCCAGCTGCTGCTGGCCAAGGGGGCGGACCCAAACCTGAGG
GCCAGCGAGTACCCGGCATTCAAGTGCGTCACGCACCACCGCGAGCACTTCCTCCCGGCGCTGGTGGCGGCCGGG
GCGCGGCTCAACACGCCCAAGGGCATCCTGGAGACGGCTGTGTCGTCCAATAACGGCCAGGCGCTGGGCTGGCTG
CTGGATCAGGGCCTGGATCCCGATGACAAGAATGCCAAGGGTCACACGGCACTGACGAGCGCCATTCGCGACGAT
CGCGCCGATTTCGTCGACACACTACTGGCGCACGGGGCCAACCCCAATATCCGCGGCCAGGACTGGCCCTTGTGC
ATGGCGGTCAAGCACCCGGGAATTCTCAAGCGTATACTGGAGACGCTGCCCGAGCCGCGAGCCTTCAAGGGCGTG
GTGGAGATGGCCGTGGTGGCCAACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTATCGGTCGAGGAT
CGCAATGGTGGCGTCTTCTCGCCCCTGACGACGGCCCTGCGCGAGCGGCGACGTGAGATCGTGCAGTTCCTGATT
GAAGAGGGCGGCGCCGACGTCAACGCCCCTGGCGAGCATCTTCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAA
GAGGAGCACCAGGATATGATTGAGATGCTGCTGAACAAGGGCGCTGATCCGAACAAGGTGTACCGCGGATGGAAC
GGCGTGATGCAGGCGCTGGAGAATGGCGACGCGGCGATGCTGGAGAGGCTGTGTGCCAAGTCCGGAGTCGATCTG
GACGTCAAGGATGAGCTGGGCCGCAACGTGACGGAGATTGCCGTGTCGAGGCGGTGGGAGGAGGCTGTGAATATC
CTGTTGGGCAACGCCATCAAGACGACGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail