Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02881
Gene name
Locationscaffold_02:5009265..5011244
Strand-
Gene length (bp)1979
Transcript length (bp)1812
Coding sequence length (bp)1812
Protein length (aa) 604

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 2.8E-88 34 466

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 113 135 22
3 142 164 22
4 168 187 19
5 194 216 22
6 236 258 22
7 296 315 19
8 330 349 19
9 361 383 22
10 398 420 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 76.52 43.60 109.43
Alive In ants, during behavior modification 30.68 16.10 45.26
Dead In ants, recently dead 26.71 14.33 39.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.478045 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02881
MAPSQPPAQFEHSVATHAKKKKRYGPYPLEPITVFYFFLAANVVAALWAPIQDCDETFNYWEPTHYLSRGYGLQT
WEYSPDYAIRSWLYIALHAVVGTARRILPHSSKVSEFYFVRYALAFVCAICQTILFKAICLSLNARVAVFFILAT
ISSPGNFHASTAFLPSSFAMYTAMLGAACFMNWRGGLKTSRGIFWFAVGAILGWPFAAALCAPFVVEEVVLAVFS
DGQATFEAFVRLFRGGVAGLLVLLTDFLVNLFFYRKATIVTWNIVKYNIFSSNGGPELYGTEPWHFYLKNLALNF
NMWFVLALLALPIFLLQKALSSSGHGFQSGLRTVVFIAPFYMWLAIFTAQPHKEERFMYPLYPFLALNASMSLHM
ILSALGRVGPRSLIGRIPGRVKLLGAVLVLLSSLILGLSRIYGVYSAYSAPLRIYQPLWGDARGNNATGRPEDSV
CFGKEWYRFPTSYFLPRGMHAKFIRSDFHGLLPGEFSQAKTGFGLWSGTWLPTRGLNNANKEDATTYVDVRACAL
LVDTQYPDRAEPPPPSPNEPDYASDEGTWAVVKCEPFLDAAATHLFARALWVPDLAIVPHRLRRKWGRHCLLQRR
RNY*
Coding >Ophcf2|02881
ATGGCGCCGTCCCAACCACCAGCGCAGTTCGAGCACTCAGTAGCCACCCATGCCAAGAAAAAGAAGCGGTACGGG
CCGTACCCTCTCGAACCCATCACCGTCTTCTACTTCTTCCTCGCTGCCAACGTCGTGGCCGCGTTGTGGGCACCT
ATTCAGGACTGCGACGAGACTTTCAACTACTGGGAGCCTACCCACTATCTCTCTCGTGGCTATGGCCTCCAGACT
TGGGAGTATTCTCCCGACTACGCCATCCGCAGCTGGCTCTACATCGCCCTGCACGCCGTCGTGGGAACCGCACGC
CGGATTCTTCCGCACTCGTCCAAGGTATCCGAGTTCTATTTCGTACGCTACGCACTGGCCTTCGTCTGCGCCATC
TGCCAAACGATCCTCTTCAAAGCCATCTGCCTCTCCCTCAACGCCCGCGTCGCCGTCTTCTTCATCCTCGCCACC
ATCTCCAGCCCCGGAAACTTCCACGCAAGCACCGCCTTTCTACCCTCGAGCTTCGCCATGTACACGGCCATGCTA
GGCGCCGCCTGTTTCATGAATTGGCGCGGCGGGCTCAAGACATCGCGCGGCATCTTCTGGTTTGCCGTTGGCGCC
ATTCTCGGCTGGCCCTTTGCCGCCGCTCTTTGCGCGCCTTTTGTCGTTGAGGAGGTTGTCCTGGCTGTCTTTAGC
GATGGGCAGGCCACCTTTGAGGCCTTTGTTCGTCTTTTTCGCGGTGGCGTCGCGGGTTTACTTGTTCTGCTCACC
GACTTCCTCGTCAACCTCTTCTTTTACCGAAAAGCGACAATCGTCACATGGAACATCGTAAAGTACAACATCTTC
TCTTCCAACGGCGGCCCCGAGCTGTACGGCACCGAGCCCTGGCACTTCTACCTCAAGAACCTAGCCCTCAACTTC
AACATGTGGTTCGTCCTGGCCCTACTGGCGCTGCCCATTTTCCTCCTCCAAAAAGCCCTCTCGTCATCCGGACAC
GGCTTTCAATCCGGATTGCGCACCGTCGTCTTCATCGCCCCTTTTTACATGTGGCTCGCCATCTTTACGGCCCAG
CCGCACAAGGAAGAGCGATTCATGTACCCGCTATACCCATTCCTAGCGCTCAACGCGTCCATGTCCCTGCACATG
ATCCTATCTGCCTTGGGTCGCGTAGGCCCGAGATCGCTGATAGGCAGGATCCCCGGACGAGTCAAACTCCTCGGC
GCAGTACTCGTCCTGCTCTCGTCACTGATTCTCGGACTATCCCGTATCTACGGCGTCTACTCAGCCTACAGCGCC
CCCTTACGCATCTACCAACCACTCTGGGGTGACGCCCGAGGCAACAACGCAACCGGCAGACCCGAAGACTCAGTC
TGTTTCGGCAAAGAATGGTACCGCTTCCCAACATCCTACTTCCTCCCCCGCGGCATGCACGCCAAATTCATCCGC
TCCGACTTCCACGGCCTCCTCCCAGGCGAATTCTCCCAAGCAAAGACCGGCTTCGGCCTCTGGAGCGGCACCTGG
CTCCCCACCCGCGGCCTCAACAACGCCAACAAAGAAGACGCAACCACCTACGTCGACGTCCGCGCCTGCGCCCTC
CTCGTCGACACGCAGTACCCAGACCGCGCCGAGCCACCACCGCCCTCGCCCAACGAGCCCGACTACGCGTCCGAT
GAGGGAACGTGGGCCGTCGTCAAGTGCGAGCCCTTTCTCGACGCGGCGGCCACGCACCTCTTTGCTCGCGCGCTC
TGGGTGCCGGATCTGGCGATTGTGCCGCATCGGCTGAGGAGGAAATGGGGGCGGCACTGTCTTCTGCAGAGGCGG
AGGAATTATTGA
Transcript >Ophcf2|02881
ATGGCGCCGTCCCAACCACCAGCGCAGTTCGAGCACTCAGTAGCCACCCATGCCAAGAAAAAGAAGCGGTACGGG
CCGTACCCTCTCGAACCCATCACCGTCTTCTACTTCTTCCTCGCTGCCAACGTCGTGGCCGCGTTGTGGGCACCT
ATTCAGGACTGCGACGAGACTTTCAACTACTGGGAGCCTACCCACTATCTCTCTCGTGGCTATGGCCTCCAGACT
TGGGAGTATTCTCCCGACTACGCCATCCGCAGCTGGCTCTACATCGCCCTGCACGCCGTCGTGGGAACCGCACGC
CGGATTCTTCCGCACTCGTCCAAGGTATCCGAGTTCTATTTCGTACGCTACGCACTGGCCTTCGTCTGCGCCATC
TGCCAAACGATCCTCTTCAAAGCCATCTGCCTCTCCCTCAACGCCCGCGTCGCCGTCTTCTTCATCCTCGCCACC
ATCTCCAGCCCCGGAAACTTCCACGCAAGCACCGCCTTTCTACCCTCGAGCTTCGCCATGTACACGGCCATGCTA
GGCGCCGCCTGTTTCATGAATTGGCGCGGCGGGCTCAAGACATCGCGCGGCATCTTCTGGTTTGCCGTTGGCGCC
ATTCTCGGCTGGCCCTTTGCCGCCGCTCTTTGCGCGCCTTTTGTCGTTGAGGAGGTTGTCCTGGCTGTCTTTAGC
GATGGGCAGGCCACCTTTGAGGCCTTTGTTCGTCTTTTTCGCGGTGGCGTCGCGGGTTTACTTGTTCTGCTCACC
GACTTCCTCGTCAACCTCTTCTTTTACCGAAAAGCGACAATCGTCACATGGAACATCGTAAAGTACAACATCTTC
TCTTCCAACGGCGGCCCCGAGCTGTACGGCACCGAGCCCTGGCACTTCTACCTCAAGAACCTAGCCCTCAACTTC
AACATGTGGTTCGTCCTGGCCCTACTGGCGCTGCCCATTTTCCTCCTCCAAAAAGCCCTCTCGTCATCCGGACAC
GGCTTTCAATCCGGATTGCGCACCGTCGTCTTCATCGCCCCTTTTTACATGTGGCTCGCCATCTTTACGGCCCAG
CCGCACAAGGAAGAGCGATTCATGTACCCGCTATACCCATTCCTAGCGCTCAACGCGTCCATGTCCCTGCACATG
ATCCTATCTGCCTTGGGTCGCGTAGGCCCGAGATCGCTGATAGGCAGGATCCCCGGACGAGTCAAACTCCTCGGC
GCAGTACTCGTCCTGCTCTCGTCACTGATTCTCGGACTATCCCGTATCTACGGCGTCTACTCAGCCTACAGCGCC
CCCTTACGCATCTACCAACCACTCTGGGGTGACGCCCGAGGCAACAACGCAACCGGCAGACCCGAAGACTCAGTC
TGTTTCGGCAAAGAATGGTACCGCTTCCCAACATCCTACTTCCTCCCCCGCGGCATGCACGCCAAATTCATCCGC
TCCGACTTCCACGGCCTCCTCCCAGGCGAATTCTCCCAAGCAAAGACCGGCTTCGGCCTCTGGAGCGGCACCTGG
CTCCCCACCCGCGGCCTCAACAACGCCAACAAAGAAGACGCAACCACCTACGTCGACGTCCGCGCCTGCGCCCTC
CTCGTCGACACGCAGTACCCAGACCGCGCCGAGCCACCACCGCCCTCGCCCAACGAGCCCGACTACGCGTCCGAT
GAGGGAACGTGGGCCGTCGTCAAGTGCGAGCCCTTTCTCGACGCGGCGGCCACGCACCTCTTTGCTCGCGCGCTC
TGGGTGCCGGATCTGGCGATTGTGCCGCATCGGCTGAGGAGGAAATGGGGGCGGCACTGTCTTCTGCAGAGGCGG
AGGAATTATTGA
Gene >Ophcf2|02881
ATGGCGCCGTCCCAACCACCAGCGCAGTTCGAGCACTCAGTAGCCACCCATGCCAAGAAAAAGAAGTACGCCATC
AATCATATTCATCTGTTCCAACTCTGCTCTCTTTCTCTAAAAGCTCTCTAGGCGGTACGGGCCGTACCCTCTCGA
ACCCATCACCGTCTTCTACTTCTTCCTCGCTGCCAACGTCGTGGCCGCGTTGTGGGCACCTATTCAGGACTGCGA
CGAGACTTTCAACTACTGGGAGCCTACCCACTATCTCTCTCGTGGCTATGGCCTCCAGACTTGGGAGTATTCTCC
CGACTACGCCATCCGCAGCTGGCTCTACATCGCCCTGCACGCCGTCGTGGGAACCGCACGCCGGATTCTTCCGCA
CTCGTCCAAGGTTAATTCTCATCCTTATTTCCCTTCAATTTCGACTCCTAATCGTTCTCAGGTATCCGAGTTCTA
TTTCGTACGCTACGCACTGGCCTTCGTCTGCGCCATCTGCCAAACGATCCTCTTCAAAGCCATCTGCCTCTCCCT
CAACGCCCGCGTCGCCGTCTTCTTCATCCTCGCCACCATCTCCAGCCCCGGAAACTTCCACGCAAGCACCGCCTT
TCTACCCTCGAGCTTCGCCATGTACACGGCCATGCTAGGCGCCGCCTGTTTCATGAATTGGCGCGGCGGGCTCAA
GACATCGCGCGGCATCTTCTGGTTTGCCGTTGGCGCCATTCTCGGCTGGCCCTTTGCCGCCGCTCTTTGCGCGCC
TTTTGTCGTTGAGGAGGTTGTCCTGGCTGTCTTTAGCGATGGGCAGGCCACCTTTGAGGCCTTTGTTCGTCTTTT
TCGCGGTGGCGTCGCGGGTTTACTTGTTCTGGTGAGCACATGCTGGCGATACACTGGCCTTGAAACCTCAACTTA
CGCGCTCCAAGCTCACCGACTTCCTCGTCAACCTCTTCTTTTACCGAAAAGCGACAATCGTCACATGGAACATCG
TAAAGTACAACATCTTCTCTTCCAACGGCGGCCCCGAGCTGTACGGCACCGAGCCCTGGCACTTCTACCTCAAGA
ACCTAGCCCTCAACTTCAACATGTGGTTCGTCCTGGCCCTACTGGCGCTGCCCATTTTCCTCCTCCAAAAAGCCC
TCTCGTCATCCGGACACGGCTTTCAATCCGGATTGCGCACCGTCGTCTTCATCGCCCCTTTTTACATGTGGCTCG
CCATCTTTACGGCCCAGCCGCACAAGGAAGAGCGATTCATGTACCCGCTATACCCATTCCTAGCGCTCAACGCGT
CCATGTCCCTGCACATGATCCTATCTGCCTTGGGTCGCGTAGGCCCGAGATCGCTGATAGGCAGGATCCCCGGAC
GAGTCAAACTCCTCGGCGCAGTACTCGTCCTGCTCTCGTCACTGATTCTCGGACTATCCCGTATCTACGGCGTCT
ACTCAGCCTACAGCGCCCCCTTACGCATCTACCAACCACTCTGGGGTGACGCCCGAGGCAACAACGCAACCGGCA
GACCCGAAGACTCAGTCTGTTTCGGCAAAGAATGGTACCGCTTCCCAACATCCTACTTCCTCCCCCGCGGCATGC
ACGCCAAATTCATCCGCTCCGACTTCCACGGCCTCCTCCCAGGCGAATTCTCCCAAGCAAAGACCGGCTTCGGCC
TCTGGAGCGGCACCTGGCTCCCCACCCGCGGCCTCAACAACGCCAACAAAGAAGACGCAACCACCTACGTCGACG
TCCGCGCCTGCGCCCTCCTCGTCGACACGCAGTACCCAGACCGCGCCGAGCCACCACCGCCCTCGCCCAACGAGC
CCGACTACGCGTCCGATGAGGGAACGTGGGCCGTCGTCAAGTGCGAGCCCTTTCTCGACGCGGCGGCCACGCACC
TCTTTGCTCGCGCGCTCTGGGTGCCGGATCTGGCGATTGTGCCGCATCGGCTGAGGAGGAAATGGGGGCGGCACT
GTCTTCTGCAGAGGCGGAGGAATTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail