Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02869
Gene name
Locationscaffold_02:4979772..4981290
Strand+
Gene length (bp)1518
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02434 Fringe Fringe-like 9.9E-07 232 328
PF04646 DUF604 Protein of unknown function, DUF604 1.4E-06 283 366

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02869
MRRRKRLTLVYLSAVVAFVLVCGLMRHGFAFGSDPAFLRAGLSTAAKTCALDASHLADIKQRYDVDHRFHYFTRT
IRFRPTKGLERKPMTLLSQTLLTASNPTTVDVSDPEAAFYGDCPPPLHVKVPVSDLPSTVNASDFMFGISTTYQR
LNESRSEIVADWKYWLTDGNGQSNGAKLYLTLLEASNDQLLQVSASLRQAGIDAAVHRSQDRDMPVRYINLVPHL
YRHQDSPSRKWLVLCDDDTFFPSMHSLVRRFSSFDHTRELYVGTLSEDVGAVERHGSQAFGGAGVFLSLPMAKRI
TQSIDQCASSEKVDEAGWQGDKLLRNCIYDHSDTRLVLLPDLWQLDFRGDPAGFYEWGLKPLSLHHYRGGGWHTA
RPAQFSKIAYVCGEDCILQRFQTADNFILSGHSVAYYPAGITFDTSQVERTFEALQDKSWNFDFVFGPQRPPLRG
KGQKIAWEIRGSDVGADGSVVQTFVRKKDHVRWEGSAGQQMGELDSVVELVWRPF*
Coding >Ophcf2|02869
ATGCGCCGCCGCAAGAGATTGACGCTCGTCTACCTTTCTGCTGTCGTCGCCTTCGTTCTCGTCTGCGGCCTGATG
CGCCATGGCTTCGCCTTCGGTTCGGATCCCGCCTTCTTGCGAGCTGGACTCTCAACCGCTGCCAAGACGTGCGCT
TTAGATGCTTCGCACTTGGCGGATATCAAGCAACGATACGATGTCGACCATCGGTTCCACTACTTCACTCGAACA
ATCCGCTTTCGACCTACAAAGGGCCTCGAGCGAAAACCCATGACCCTGTTATCTCAGACGCTCCTCACCGCCTCA
AATCCCACGACAGTCGACGTCTCCGACCCTGAAGCCGCCTTCTACGGAGACTGCCCCCCCCCCCTTCATGTCAAA
GTGCCCGTTTCCGACCTGCCTTCGACGGTCAACGCATCCGACTTCATGTTCGGCATCTCAACCACGTACCAGCGC
CTCAACGAGTCTCGCTCCGAAATCGTCGCCGACTGGAAATATTGGCTCACCGATGGCAACGGCCAATCCAACGGC
GCCAAGCTCTATCTCACCCTCCTCGAAGCCAGCAACGACCAGCTCCTCCAAGTCAGCGCGAGTCTCCGACAGGCC
GGCATCGACGCCGCCGTCCACCGTTCCCAAGACCGAGATATGCCGGTCCGCTACATCAACCTTGTCCCCCATCTA
TACCGACACCAAGACTCGCCCTCGCGCAAGTGGCTGGTCCTCTGCGACGACGATACCTTTTTCCCTAGCATGCAC
AGCCTCGTCCGTCGATTCTCCTCCTTCGACCACACCCGCGAACTCTACGTCGGCACCCTCTCCGAAGACGTCGGT
GCCGTCGAGCGCCACGGCTCTCAGGCTTTTGGCGGCGCCGGCGTCTTCCTCTCGCTGCCCATGGCCAAGCGCATA
ACACAGTCCATCGATCAGTGCGCCTCGTCGGAAAAGGTCGACGAGGCCGGCTGGCAGGGAGACAAGCTGCTGCGC
AACTGCATCTACGACCACAGCGATACCCGCCTCGTCCTACTGCCTGACCTCTGGCAGCTCGACTTCCGCGGCGAC
CCTGCCGGCTTCTACGAGTGGGGGCTCAAGCCGCTATCGCTACACCACTACCGCGGCGGCGGCTGGCACACGGCG
CGCCCGGCCCAGTTCAGCAAAATCGCCTACGTCTGCGGCGAGGACTGCATCCTCCAGCGCTTCCAGACGGCCGAC
AACTTCATCCTCTCCGGTCACTCCGTCGCCTACTACCCGGCCGGCATCACCTTCGACACCAGCCAGGTAGAGCGC
ACCTTTGAGGCGCTGCAGGACAAGAGCTGGAACTTCGACTTCGTCTTTGGGCCTCAGCGGCCGCCCCTCAGGGGA
AAAGGCCAGAAGATTGCCTGGGAGATTCGCGGTTCTGATGTTGGGGCTGATGGGTCGGTGGTGCAGACGTTTGTG
AGGAAGAAGGATCATGTTCGCTGGGAGGGGAGTGCCGGACAGCAGATGGGCGAGCTGGATAGCGTTGTTGAGCTG
GTTTGGAGACCTTTTTAG
Transcript >Ophcf2|02869
ATGCGCCGCCGCAAGAGATTGACGCTCGTCTACCTTTCTGCTGTCGTCGCCTTCGTTCTCGTCTGCGGCCTGATG
CGCCATGGCTTCGCCTTCGGTTCGGATCCCGCCTTCTTGCGAGCTGGACTCTCAACCGCTGCCAAGACGTGCGCT
TTAGATGCTTCGCACTTGGCGGATATCAAGCAACGATACGATGTCGACCATCGGTTCCACTACTTCACTCGAACA
ATCCGCTTTCGACCTACAAAGGGCCTCGAGCGAAAACCCATGACCCTGTTATCTCAGACGCTCCTCACCGCCTCA
AATCCCACGACAGTCGACGTCTCCGACCCTGAAGCCGCCTTCTACGGAGACTGCCCCCCCCCCCTTCATGTCAAA
GTGCCCGTTTCCGACCTGCCTTCGACGGTCAACGCATCCGACTTCATGTTCGGCATCTCAACCACGTACCAGCGC
CTCAACGAGTCTCGCTCCGAAATCGTCGCCGACTGGAAATATTGGCTCACCGATGGCAACGGCCAATCCAACGGC
GCCAAGCTCTATCTCACCCTCCTCGAAGCCAGCAACGACCAGCTCCTCCAAGTCAGCGCGAGTCTCCGACAGGCC
GGCATCGACGCCGCCGTCCACCGTTCCCAAGACCGAGATATGCCGGTCCGCTACATCAACCTTGTCCCCCATCTA
TACCGACACCAAGACTCGCCCTCGCGCAAGTGGCTGGTCCTCTGCGACGACGATACCTTTTTCCCTAGCATGCAC
AGCCTCGTCCGTCGATTCTCCTCCTTCGACCACACCCGCGAACTCTACGTCGGCACCCTCTCCGAAGACGTCGGT
GCCGTCGAGCGCCACGGCTCTCAGGCTTTTGGCGGCGCCGGCGTCTTCCTCTCGCTGCCCATGGCCAAGCGCATA
ACACAGTCCATCGATCAGTGCGCCTCGTCGGAAAAGGTCGACGAGGCCGGCTGGCAGGGAGACAAGCTGCTGCGC
AACTGCATCTACGACCACAGCGATACCCGCCTCGTCCTACTGCCTGACCTCTGGCAGCTCGACTTCCGCGGCGAC
CCTGCCGGCTTCTACGAGTGGGGGCTCAAGCCGCTATCGCTACACCACTACCGCGGCGGCGGCTGGCACACGGCG
CGCCCGGCCCAGTTCAGCAAAATCGCCTACGTCTGCGGCGAGGACTGCATCCTCCAGCGCTTCCAGACGGCCGAC
AACTTCATCCTCTCCGGTCACTCCGTCGCCTACTACCCGGCCGGCATCACCTTCGACACCAGCCAGGTAGAGCGC
ACCTTTGAGGCGCTGCAGGACAAGAGCTGGAACTTCGACTTCGTCTTTGGGCCTCAGCGGCCGCCCCTCAGGGGA
AAAGGCCAGAAGATTGCCTGGGAGATTCGCGGTTCTGATGTTGGGGCTGATGGGTCGGTGGTGCAGACGTTTGTG
AGGAAGAAGGATCATGTTCGCTGGGAGGGGAGTGCCGGACAGCAGATGGGCGAGCTGGATAGCGTTGTTGAGCTG
GTTTGGAGACCTTTTTAG
Gene >Ophcf2|02869
ATGCGCCGCCGCAAGAGATTGACGCTCGTCTACCTTTCTGCTGTCGTCGCCTTCGTTCTCGTCTGCGGCCTGATG
CGCCATGGCTTCGCCTTCGGTTCGGATCCCGCCTTCTTGCGAGCTGGACTCTCAACCGCTGCCAAGACGTGCGCT
TTAGATGCTTCGCACTTGGCGGATATCAAGCAACGATACGATGTCGACCATCGGTTCCACTACTTCACTCGAACA
ATCCGCTTTCGACCTACAAAGGGCCTCGAGCGAAAACCCATGACCCTGTTATCTCAGACGCTCCTCACCGCCTCA
AATCCCACGACAGTCGACGTCTCCGACCCTGAAGCCGCCTTCTACGGAGACTGCCCCCCCCCCCTTCATGTCAAA
GTGCCCGTTTCCGACCTGCCTTCGACGGTCAACGCATCCGACTTCATGTTCGGCATCTCAACCACGTACCAGCGC
CTCAACGAGTCTCGCTCCGAAATCGTCGCCGACTGGAAATATTGGCTCACCGATGGCAACGGCCAATCCAACGGC
GCCAAGCTCTATCTCACCCTCCTCGAAGCCAGCAACGACCAGCTCCTCCAAGTCAGCGCGAGTCTCCGACAGGCC
GGCATCGACGCCGCCGTCCACCGTTCCCAAGACCGAGATATGCCGGTCCGCTACATCAACCTTGTCCCCCATCTA
TACCGACACCAAGACTCGCCCTCGCGCAAGTGGCTGGTCCTCTGCGACGACGATACCTTTTTCCCTAGCATGCAC
AGCCTCGTCCGTCGATTCTCCTCCTTCGACCACACCCGCGAACTCTACGTCGGCACCCTCTCCGAAGACGTCGGT
GCCGTCGAGCGCCACGGCTCTCAGGCTTTTGGCGGCGCCGGCGTCTTCCTCTCGCTGCCCATGGCCAAGCGCATA
ACACAGTCCATCGATCAGTGCGCCTCGTCGGAAAAGGTCGACGAGGCCGGCTGGCAGGGAGACAAGCTGCTGCGC
AACTGCATCTACGACCACAGCGATACCCGCCTCGTCCTACTGCCTGACCTCTGGCAGCTCGACTTCCGCGGCGAC
CCTGCCGGCTTCTACGAGTGGGGGCTCAAGCCGCTATCGCTACACCACTACCGCGGCGGCGGCTGGCACACGGCG
CGCCCGGCCCAGTTCAGCAAAATCGCCTACGTCTGCGGCGAGGACTGCATCCTCCAGCGCTTCCAGACGGCCGAC
AACTTCATCCTCTCCGGTCACTCCGTCGCCTACTACCCGGCCGGCATCACCTTCGACACCAGCCAGGTAGAGCGC
ACCTTTGAGGCGCTGCAGGACAAGAGCTGGAACTTCGACTTCGTCTTTGGGCCTCAGCGGCCGCCCCTCAGGGGA
AAAGGCCAGAAGATTGCCTGGGAGATTCGCGGTTCTGATGTTGGGGCTGATGGGTCGGTGGTGCAGACGTTTGTG
AGGAAGAAGGATCATGTTCGCTGGGAGGGGAGTGCCGGACAGCAGATGGGCGAGCTGGATAGCGTTGTTGAGCTG
GTTTGGAGACCTTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail