Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02866
Gene name
Locationscaffold_02:4973387..4974821
Strand+
Gene length (bp)1434
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03583 LIP Secretory lipase 1.4E-73 161 431

GO

GO Term Description Terminal node
GO:0004806 triglyceride lipase activity Yes
GO:0016042 lipid catabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901575 organic substance catabolic process No
GO:0003674 molecular_function No
GO:0016298 lipase activity No
GO:0016787 hydrolase activity No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02866
MVASRLRVAAAVLVAAATATVMAAPPMAAPRSVPSVSGLQSAPSVAPRDLATLTPPSRDAFYRVPDGLSGVKPGT
ILRHRRPPNPIAAFGIIPLNLKDSHQLLYRTTDSLGNATATVVTVLVPFDADYGKVLSYQVAEDAASIDCSPSYA
FQLDHARGPGFGTILTEAELLLVEAALQQGWIVIVPDFLGPKAAFLANELAGQATLDGIRAAINSEPLTGISSRP
RVAMWGYSGGSLASLWAAELQPTYAPELGSLIAGAAVGGTVPNISSVVNSINKGPSAGLIPAGMVGLANQHADLD
ALLQKHVLPQYKDEFFSPRRQCFEANNRHFANKDVAGMLDDPTLIFRNPLAVALTAKNKLGNATPEIPLFVYKST
KDEISPVAETDTMVRKYCAKGTSVEYVRDRSFDHTQLAIAGAPGALIWLRDTLNGRERRGQKCVTRTVLSSLLDP
RVWLVLPKILVDALLGALGKRIGPPFS*
Coding >Ophcf2|02866
ATGGTTGCTTCTCGACTCCGGGTGGCGGCAGCCGTGCTCGTGGCGGCGGCGACGGCCACGGTGATGGCTGCTCCG
CCAATGGCTGCTCCGCGTTCTGTCCCGTCGGTTTCTGGTCTGCAATCTGCTCCTTCGGTGGCGCCTCGCGACCTG
GCGACCCTCACGCCTCCAAGCCGTGACGCCTTCTACCGCGTTCCGGACGGACTGAGCGGAGTGAAGCCGGGAACG
ATCCTCAGGCATCGTCGGCCGCCGAACCCCATCGCGGCCTTTGGCATCATTCCTCTTAACCTCAAGGACAGCCAC
CAGCTGCTATATCGCACCACGGACAGCTTGGGGAACGCGACGGCAACGGTGGTGACAGTGCTGGTTCCCTTCGAC
GCCGACTACGGCAAGGTGCTCTCGTATCAGGTGGCCGAGGACGCGGCGTCTATCGACTGCTCGCCATCGTACGCT
TTCCAGCTCGACCACGCTAGGGGGCCAGGCTTTGGCACGATCCTGACCGAGGCTGAGCTGTTGCTCGTCGAGGCC
GCACTCCAGCAGGGTTGGATCGTCATCGTGCCCGACTTCCTCGGCCCAAAAGCAGCATTCTTGGCCAATGAGCTG
GCAGGTCAAGCAACACTCGATGGGATCCGCGCCGCCATCAACTCGGAGCCCCTGACGGGTATCAGTTCGCGGCCG
AGGGTGGCCATGTGGGGATACTCGGGCGGCAGTCTCGCGTCCCTGTGGGCAGCGGAGCTTCAACCGACGTACGCG
CCGGAACTAGGGTCTCTCATAGCCGGCGCGGCGGTGGGCGGAACGGTGCCCAATATCTCGTCCGTCGTCAACAGC
ATCAACAAGGGGCCCTCGGCCGGCCTGATCCCCGCTGGCATGGTCGGGCTCGCCAACCAGCATGCGGACCTGGAC
GCGCTGCTGCAGAAACACGTCCTACCCCAATACAAGGACGAGTTCTTCTCTCCACGCAGGCAGTGCTTCGAGGCC
AACAATCGACACTTCGCTAACAAGGACGTGGCCGGCATGCTCGACGACCCGACGCTCATCTTCCGCAACCCGCTG
GCAGTGGCTCTGACGGCCAAGAACAAGCTCGGAAACGCGACGCCCGAAATACCGCTCTTCGTGTACAAGTCGACA
AAGGACGAAATCAGCCCCGTGGCCGAGACGGACACCATGGTTCGCAAGTACTGCGCAAAGGGGACGTCTGTCGAG
TACGTGCGAGACAGGAGCTTCGACCACACGCAACTGGCCATCGCGGGGGCCCCCGGGGCGCTTATCTGGCTGAGG
GATACGCTCAACGGGAGGGAACGGCGCGGACAAAAGTGTGTTACGAGGACGGTGCTCTCGTCGCTGCTCGATCCT
AGGGTTTGGCTCGTCTTGCCTAAGATTCTGGTTGATGCGCTGCTAGGGGCGCTGGGGAAGAGGATCGGGCCCCCG
TTCAGCTGA
Transcript >Ophcf2|02866
ATGGTTGCTTCTCGACTCCGGGTGGCGGCAGCCGTGCTCGTGGCGGCGGCGACGGCCACGGTGATGGCTGCTCCG
CCAATGGCTGCTCCGCGTTCTGTCCCGTCGGTTTCTGGTCTGCAATCTGCTCCTTCGGTGGCGCCTCGCGACCTG
GCGACCCTCACGCCTCCAAGCCGTGACGCCTTCTACCGCGTTCCGGACGGACTGAGCGGAGTGAAGCCGGGAACG
ATCCTCAGGCATCGTCGGCCGCCGAACCCCATCGCGGCCTTTGGCATCATTCCTCTTAACCTCAAGGACAGCCAC
CAGCTGCTATATCGCACCACGGACAGCTTGGGGAACGCGACGGCAACGGTGGTGACAGTGCTGGTTCCCTTCGAC
GCCGACTACGGCAAGGTGCTCTCGTATCAGGTGGCCGAGGACGCGGCGTCTATCGACTGCTCGCCATCGTACGCT
TTCCAGCTCGACCACGCTAGGGGGCCAGGCTTTGGCACGATCCTGACCGAGGCTGAGCTGTTGCTCGTCGAGGCC
GCACTCCAGCAGGGTTGGATCGTCATCGTGCCCGACTTCCTCGGCCCAAAAGCAGCATTCTTGGCCAATGAGCTG
GCAGGTCAAGCAACACTCGATGGGATCCGCGCCGCCATCAACTCGGAGCCCCTGACGGGTATCAGTTCGCGGCCG
AGGGTGGCCATGTGGGGATACTCGGGCGGCAGTCTCGCGTCCCTGTGGGCAGCGGAGCTTCAACCGACGTACGCG
CCGGAACTAGGGTCTCTCATAGCCGGCGCGGCGGTGGGCGGAACGGTGCCCAATATCTCGTCCGTCGTCAACAGC
ATCAACAAGGGGCCCTCGGCCGGCCTGATCCCCGCTGGCATGGTCGGGCTCGCCAACCAGCATGCGGACCTGGAC
GCGCTGCTGCAGAAACACGTCCTACCCCAATACAAGGACGAGTTCTTCTCTCCACGCAGGCAGTGCTTCGAGGCC
AACAATCGACACTTCGCTAACAAGGACGTGGCCGGCATGCTCGACGACCCGACGCTCATCTTCCGCAACCCGCTG
GCAGTGGCTCTGACGGCCAAGAACAAGCTCGGAAACGCGACGCCCGAAATACCGCTCTTCGTGTACAAGTCGACA
AAGGACGAAATCAGCCCCGTGGCCGAGACGGACACCATGGTTCGCAAGTACTGCGCAAAGGGGACGTCTGTCGAG
TACGTGCGAGACAGGAGCTTCGACCACACGCAACTGGCCATCGCGGGGGCCCCCGGGGCGCTTATCTGGCTGAGG
GATACGCTCAACGGGAGGGAACGGCGCGGACAAAAGTGTGTTACGAGGACGGTGCTCTCGTCGCTGCTCGATCCT
AGGGTTTGGCTCGTCTTGCCTAAGATTCTGGTTGATGCGCTGCTAGGGGCGCTGGGGAAGAGGATCGGGCCCCCG
TTCAGCTGA
Gene >Ophcf2|02866
ATGGTTGCTTCTCGACTCCGGGTGGCGGCAGCCGTGCTCGTGGCGGCGGCGACGGCCACGGTGATGGCTGCTCCG
CCAATGGCTGCTCCGCGTTCTGTCCCGTCGGTTTCTGGTCTGCAATCTGCTCCTTCGGTGGCGCCTCGCGACCTG
GCGACCCTCACGCCTCCAAGCCGTGACGCCTTCTACCGCGTTCCGGACGGACTGAGCGGAGTGAAGCCGGGAACG
ATCCTCAGGCATCGTCGGCCGCCGAACCCCATCGCGGCCTTTGGCATCATTCCTCTTAACCTCAAGGACAGCCAC
CAGCTGCTATATCGCACCACGGACAGCTTGGGGAACGCGACGGCAACGGTGGTGACAGTGCTGGTTCCCTTCGAC
GCCGACTACGGCAAGGTGCTCTCGTATCAGGTGGCCGAGGACGCGGCGTCTATCGACTGCTCGCCATCGTACGCT
TTCCAGCTCGACCACGCTAGGGGGCCAGGCTTTGGCACGATCCTGACCGAGGCTGAGCTGTTGCTCGTCGAGGCC
GCACTCCAGCAGGGTTGGATCGTCATCGTGCCCGACTTCCTCGGCCCAAAAGCAGCATTCTTGGCCAATGAGCTG
GCAGGTCAAGCAACACTCGATGGGATCCGCGCCGCCATCAACTCGGAGCCCCTGACGGGTATCAGTTCGCGGCCG
AGGGTGGCCATGTGGGGATACTCGGGCGGCAGTCTCGCGTCCCTGTGGGCAGCGGAGCTTCAACCGACGTACGCG
CCGGAACTAGGGTCTCTCATAGCCGGCGCGGCGGTGGGCGGAACGGTGCCCAATATCTCGTCCGTCGTCAACAGC
ATCAACAAGGGGCCCTCGGCCGGCCTGATCCCCGCTGGCATGGTCGGGCTCGCCAACCAGCATGCGGACCTGGAC
GCGCTGCTGCAGAAACACGTCCTACCCCAATACAAGGACGAGTTCTTCTCTCCACGCAGGCAGTGCTTCGAGGCC
AACAATCGACACTTCGCTAACAAGGACGTGGCCGGCATGCTCGACGACCCGACGCTCATCTTCCGCAACCCGCTG
GCAGTGGCTCTGACGGCCAAGAACAAGCTCGGAAACGCGACGCCCGAAATACCGCTCTTCGTGTACAAGTCGACA
AAGGACGAAATCAGCCCCGTGGCCGAGACGGACACCATGGTTCGCAAGTACTGCGCAAAGGGGACGTCTGTCGAG
TACGTGCGAGACAGGAGCTTCGACCACACGCAACTGGCCATCGCGGGGGCCCCCGGGGCGCTTATCTGGCTGAGG
GATACGCTCAACGGGAGGGAACGGCGCGGACAAAAGTGTGTTACGAGGACGGTGCTCTCGTCGCTGCTCGATCCT
AGGGTTTGGCTCGTCTTGCCTAAGATTCTGGTTGATGCGCTGCTAGGGGCGCTGGGGAAGAGGATCGGGCCCCCG
TTCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail