Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02865
Gene name
Locationscaffold_02:4970870..4972064
Strand+
Gene length (bp)1194
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 8.4E-10 24 74
PF04193 PQ-loop PQ loop repeat 9.6E-14 176 229

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1854 0.0627 0.0644 0.1899 0.2632 0.0128 0.3388 0.7705 0.4547 0.1427

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 52 74 22
3 99 121 22
4 144 166 22
5 171 193 22
6 205 227 22
7 237 259 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 76.61 43.37 109.86
Alive In ants, during behavior modification 74.37 41.98 106.75
Dead In ants, recently dead 67.43 37.76 97.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.906245 no
Alive Dead 0.607813 no
Dead Fungus 0.560298 no

Orthologs

Orthofinder run ID4
Orthogroup4827
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5267
Ophiocordyceps australis map64 (Brazil) OphauB2|4650
Ophiocordyceps camponoti-floridani Ophcf2|02865 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3567
Ophiocordyceps kimflemingae Ophio5|1428
Ophiocordyceps subramaniannii Hirsu2|10715

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02865
MAHMWELDNSACEHLRSPSYLELVVSIVILIGLLISYLPQHYRIISRGTSEGISPYFVLLGTTSATAGFANILTV
PPSREAIGCCRELGAFDCAAGLLGVAQLGVQWLCFTLILVLFLIFFRYREANVPQDELGGESPKWQTAVAVGLLC
VFHGLIVVILTGVFALALPSYLTTWANSLGVMAALLAAVQYVPQIWTTYRLKHVGSLSIPMMCMQTPGGFLFAAS
LFARLGVAGWSTWVIYLLTATMQGIVLVLGVYYEMDSRRHEGSMPPDLSVMPPSPLEGSPSSQRPAANRTYSEGW
ERGLPGPFTGHPERYAETEEDLDHMQEREARAIARENQPLLRPGGIGNPRRKYGSSRG*
Coding >Ophcf2|02865
ATGGCCCACATGTGGGAGTTGGACAACAGCGCATGCGAGCATCTCCGATCGCCGTCATATCTCGAGCTCGTCGTT
TCCATCGTCATCCTCATCGGACTACTGATCTCGTACCTCCCGCAGCACTACCGCATCATCTCTCGCGGAACTTCG
GAAGGAATCTCGCCGTATTTCGTCCTCCTCGGCACCACGTCTGCCACCGCCGGCTTCGCCAATATTCTGACCGTC
CCGCCCTCGAGGGAGGCTATTGGTTGTTGCAGGGAGCTCGGTGCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTT
GCTCAACTTGGAGTGCAGTGGCTTTGCTTTACGCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGGGAG
GCCAATGTCCCTCAAGACGAGCTAGGAGGGGAGTCGCCCAAGTGGCAAACGGCCGTCGCCGTCGGCCTTTTGTGC
GTCTTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCTTGGCGTTACCCAGCTACCTCACCACCTGG
GCCAACTCCCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAGATATGGACGACATACCGC
CTCAAGCACGTCGGAAGTCTCAGCATCCCCATGATGTGCATGCAGACACCCGGCGGCTTCCTCTTCGCCGCCAGT
CTCTTTGCCCGACTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTATTGACAGCAACGATGCAGGGCATC
GTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACATGAAGGCAGTATGCCCCCCGATCTGAGCGTC
ATGCCGCCCTCGCCGCTGGAAGGCTCCCCCTCATCACAACGACCGGCAGCGAACCGCACGTATTCGGAAGGATGG
GAACGCGGGTTGCCGGGGCCTTTTACCGGCCATCCAGAGCGCTACGCTGAGACGGAGGAGGATCTCGACCACATG
CAGGAGCGGGAGGCGCGAGCCATTGCGCGAGAGAACCAGCCGTTACTTCGACCGGGTGGCATTGGCAACCCGCGA
CGCAAGTACGGTTCTAGCCGCGGCTGA
Transcript >Ophcf2|02865
ATGGCCCACATGTGGGAGTTGGACAACAGCGCATGCGAGCATCTCCGATCGCCGTCATATCTCGAGCTCGTCGTT
TCCATCGTCATCCTCATCGGACTACTGATCTCGTACCTCCCGCAGCACTACCGCATCATCTCTCGCGGAACTTCG
GAAGGAATCTCGCCGTATTTCGTCCTCCTCGGCACCACGTCTGCCACCGCCGGCTTCGCCAATATTCTGACCGTC
CCGCCCTCGAGGGAGGCTATTGGTTGTTGCAGGGAGCTCGGTGCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTT
GCTCAACTTGGAGTGCAGTGGCTTTGCTTTACGCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGGGAG
GCCAATGTCCCTCAAGACGAGCTAGGAGGGGAGTCGCCCAAGTGGCAAACGGCCGTCGCCGTCGGCCTTTTGTGC
GTCTTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCTTGGCGTTACCCAGCTACCTCACCACCTGG
GCCAACTCCCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAGATATGGACGACATACCGC
CTCAAGCACGTCGGAAGTCTCAGCATCCCCATGATGTGCATGCAGACACCCGGCGGCTTCCTCTTCGCCGCCAGT
CTCTTTGCCCGACTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTATTGACAGCAACGATGCAGGGCATC
GTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACATGAAGGCAGTATGCCCCCCGATCTGAGCGTC
ATGCCGCCCTCGCCGCTGGAAGGCTCCCCCTCATCACAACGACCGGCAGCGAACCGCACGTATTCGGAAGGATGG
GAACGCGGGTTGCCGGGGCCTTTTACCGGCCATCCAGAGCGCTACGCTGAGACGGAGGAGGATCTCGACCACATG
CAGGAGCGGGAGGCGCGAGCCATTGCGCGAGAGAACCAGCCGTTACTTCGACCGGGTGGCATTGGCAACCCGCGA
CGCAAGTACGGTTCTAGCCGCGGCTGA
Gene >Ophcf2|02865
ATGGCCCACATGTGGGAGTTGGACAACAGCGCATGCGAGCATCTCCGATCGCCGTCATATCTCGAGCTCGTCGTT
TCCATGTGCGCACATGCCCTCCCTTTCCTTCCCCTTTGTCTCACTCGCTAACGACGACGGACGACAGCGTCATCC
TCATCGGACTACTGATCTCGTACCTCCCGCAGCACTACCGCATCATCTCTCGCGGAACTTCGGAAGGAATCTCGC
CGTATTTCGTCCTCCTCGGCACCACGTCTGCCACCGCCGGCTTCGCCAATATTCTGACCGTCCCGCCCTCGAGGG
AGGCTATTGGTTGTTGCAGGGAGCTCGGTGCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTTGCTCAACTTGGAG
TGCAGTGGCTTTGCTTTACGCTCATGTAAGCCCGTCTCCGGGATGCGGCGGCGGTGGTGCACCGCGCTGACGCGT
CACAGCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGGGAGGCCAATGTCCCTCAAGACGAGCTAGGAGGGGAG
TCGCCCAAGTGGCAAACGGCCGTCGCCGTCGGCCTTTTGTGCGTCTTTCACGGCCTCATCGTCGTCATTCTCACC
GGCGTCTTCGCCTTGGCGTTACCCAGCTACCTCACCACCTGGGCCAACTCCCTCGGCGTCATGGCCGCCCTCCTG
GCCGCGGTCCAGTACGTGCCGCAGATATGGACGACATACCGCCTCAAGCACGTCGGAAGTCTCAGCATCCCCATG
ATGTGCATGCAGACACCCGGCGGCTTCCTCTTCGCCGCCAGTCTCTTTGCCCGACTGGGCGTCGCCGGCTGGAGC
ACATGGGTCATCTACCTATTGACAGCAACGATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGAC
TCGCGTCGACATGAAGGCAGTATGCCCCCCGATCTGAGCGTCATGCCGCCCTCGCCGCTGGAAGGCTCCCCCTCA
TCACAACGACCGGCAGCGAACCGCACGTATTCGGAAGGATGGGAACGCGGGTTGCCGGGGCCTTTTACCGGCCAT
CCAGAGCGCTACGCTGAGACGGAGGAGGATCTCGACCACATGCAGGAGCGGGAGGCGCGAGCCATTGCGCGAGAG
AACCAGCCGTTACTTCGACCGGGTGGCATTGGCAACCCGCGACGCAAGTACGGTTCTAGCCGCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail