Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02865
Gene name
Locationscaffold_02:4970870..4972064
Strand+
Gene length (bp)1194
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 8.4E-10 24 74
PF04193 PQ-loop PQ loop repeat 9.6E-14 176 229

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 52 74 22
3 99 121 22
4 144 166 22
5 171 193 22
6 205 227 22
7 237 259 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02865
MAHMWELDNSACEHLRSPSYLELVVSIVILIGLLISYLPQHYRIISRGTSEGISPYFVLLGTTSATAGFANILTV
PPSREAIGCCRELGAFDCAAGLLGVAQLGVQWLCFTLILVLFLIFFRYREANVPQDELGGESPKWQTAVAVGLLC
VFHGLIVVILTGVFALALPSYLTTWANSLGVMAALLAAVQYVPQIWTTYRLKHVGSLSIPMMCMQTPGGFLFAAS
LFARLGVAGWSTWVIYLLTATMQGIVLVLGVYYEMDSRRHEGSMPPDLSVMPPSPLEGSPSSQRPAANRTYSEGW
ERGLPGPFTGHPERYAETEEDLDHMQEREARAIARENQPLLRPGGIGNPRRKYGSSRG*
Coding >Ophcf2|02865
ATGGCCCACATGTGGGAGTTGGACAACAGCGCATGCGAGCATCTCCGATCGCCGTCATATCTCGAGCTCGTCGTT
TCCATCGTCATCCTCATCGGACTACTGATCTCGTACCTCCCGCAGCACTACCGCATCATCTCTCGCGGAACTTCG
GAAGGAATCTCGCCGTATTTCGTCCTCCTCGGCACCACGTCTGCCACCGCCGGCTTCGCCAATATTCTGACCGTC
CCGCCCTCGAGGGAGGCTATTGGTTGTTGCAGGGAGCTCGGTGCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTT
GCTCAACTTGGAGTGCAGTGGCTTTGCTTTACGCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGGGAG
GCCAATGTCCCTCAAGACGAGCTAGGAGGGGAGTCGCCCAAGTGGCAAACGGCCGTCGCCGTCGGCCTTTTGTGC
GTCTTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCTTGGCGTTACCCAGCTACCTCACCACCTGG
GCCAACTCCCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAGATATGGACGACATACCGC
CTCAAGCACGTCGGAAGTCTCAGCATCCCCATGATGTGCATGCAGACACCCGGCGGCTTCCTCTTCGCCGCCAGT
CTCTTTGCCCGACTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTATTGACAGCAACGATGCAGGGCATC
GTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACATGAAGGCAGTATGCCCCCCGATCTGAGCGTC
ATGCCGCCCTCGCCGCTGGAAGGCTCCCCCTCATCACAACGACCGGCAGCGAACCGCACGTATTCGGAAGGATGG
GAACGCGGGTTGCCGGGGCCTTTTACCGGCCATCCAGAGCGCTACGCTGAGACGGAGGAGGATCTCGACCACATG
CAGGAGCGGGAGGCGCGAGCCATTGCGCGAGAGAACCAGCCGTTACTTCGACCGGGTGGCATTGGCAACCCGCGA
CGCAAGTACGGTTCTAGCCGCGGCTGA
Transcript >Ophcf2|02865
ATGGCCCACATGTGGGAGTTGGACAACAGCGCATGCGAGCATCTCCGATCGCCGTCATATCTCGAGCTCGTCGTT
TCCATCGTCATCCTCATCGGACTACTGATCTCGTACCTCCCGCAGCACTACCGCATCATCTCTCGCGGAACTTCG
GAAGGAATCTCGCCGTATTTCGTCCTCCTCGGCACCACGTCTGCCACCGCCGGCTTCGCCAATATTCTGACCGTC
CCGCCCTCGAGGGAGGCTATTGGTTGTTGCAGGGAGCTCGGTGCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTT
GCTCAACTTGGAGTGCAGTGGCTTTGCTTTACGCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGGGAG
GCCAATGTCCCTCAAGACGAGCTAGGAGGGGAGTCGCCCAAGTGGCAAACGGCCGTCGCCGTCGGCCTTTTGTGC
GTCTTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCTTGGCGTTACCCAGCTACCTCACCACCTGG
GCCAACTCCCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAGATATGGACGACATACCGC
CTCAAGCACGTCGGAAGTCTCAGCATCCCCATGATGTGCATGCAGACACCCGGCGGCTTCCTCTTCGCCGCCAGT
CTCTTTGCCCGACTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTATTGACAGCAACGATGCAGGGCATC
GTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACATGAAGGCAGTATGCCCCCCGATCTGAGCGTC
ATGCCGCCCTCGCCGCTGGAAGGCTCCCCCTCATCACAACGACCGGCAGCGAACCGCACGTATTCGGAAGGATGG
GAACGCGGGTTGCCGGGGCCTTTTACCGGCCATCCAGAGCGCTACGCTGAGACGGAGGAGGATCTCGACCACATG
CAGGAGCGGGAGGCGCGAGCCATTGCGCGAGAGAACCAGCCGTTACTTCGACCGGGTGGCATTGGCAACCCGCGA
CGCAAGTACGGTTCTAGCCGCGGCTGA
Gene >Ophcf2|02865
ATGGCCCACATGTGGGAGTTGGACAACAGCGCATGCGAGCATCTCCGATCGCCGTCATATCTCGAGCTCGTCGTT
TCCATGTGCGCACATGCCCTCCCTTTCCTTCCCCTTTGTCTCACTCGCTAACGACGACGGACGACAGCGTCATCC
TCATCGGACTACTGATCTCGTACCTCCCGCAGCACTACCGCATCATCTCTCGCGGAACTTCGGAAGGAATCTCGC
CGTATTTCGTCCTCCTCGGCACCACGTCTGCCACCGCCGGCTTCGCCAATATTCTGACCGTCCCGCCCTCGAGGG
AGGCTATTGGTTGTTGCAGGGAGCTCGGTGCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTTGCTCAACTTGGAG
TGCAGTGGCTTTGCTTTACGCTCATGTAAGCCCGTCTCCGGGATGCGGCGGCGGTGGTGCACCGCGCTGACGCGT
CACAGCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGGGAGGCCAATGTCCCTCAAGACGAGCTAGGAGGGGAG
TCGCCCAAGTGGCAAACGGCCGTCGCCGTCGGCCTTTTGTGCGTCTTTCACGGCCTCATCGTCGTCATTCTCACC
GGCGTCTTCGCCTTGGCGTTACCCAGCTACCTCACCACCTGGGCCAACTCCCTCGGCGTCATGGCCGCCCTCCTG
GCCGCGGTCCAGTACGTGCCGCAGATATGGACGACATACCGCCTCAAGCACGTCGGAAGTCTCAGCATCCCCATG
ATGTGCATGCAGACACCCGGCGGCTTCCTCTTCGCCGCCAGTCTCTTTGCCCGACTGGGCGTCGCCGGCTGGAGC
ACATGGGTCATCTACCTATTGACAGCAACGATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGAC
TCGCGTCGACATGAAGGCAGTATGCCCCCCGATCTGAGCGTCATGCCGCCCTCGCCGCTGGAAGGCTCCCCCTCA
TCACAACGACCGGCAGCGAACCGCACGTATTCGGAAGGATGGGAACGCGGGTTGCCGGGGCCTTTTACCGGCCAT
CCAGAGCGCTACGCTGAGACGGAGGAGGATCTCGACCACATGCAGGAGCGGGAGGCGCGAGCCATTGCGCGAGAG
AACCAGCCGTTACTTCGACCGGGTGGCATTGGCAACCCGCGACGCAAGTACGGTTCTAGCCGCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail