Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02862
Gene name
Locationscaffold_02:4965502..4966675
Strand+
Gene length (bp)1173
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 217 239 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.14 0.00 2.28
Alive In ants, during behavior modification 53.54 28.88 78.19
Dead In ants, recently dead 52.40 28.43 76.37

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.924833 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02862
MARSTTWSAPDPPTTTRPALSKRRDAGTVCGFIGGDAAFPATCIAGSHCAVDVAHGVVGCCPDDGPCATGVFTGC
VDAHSGPQSVSDPYVFTCSDGGDVCYRNLFEGGFYQFGCGAGSHLATSVATSPPDGMAGLAIARVTLAMTESVRA
FATPVEVGGFVTPSFATTTTMTTMTTSTMDSETTSLARAADNPTSRLAFGPVSAPPRESSTPPSGAVIGGIIGGV
FGLGLLLAAIIFVCCRRRRRSMERVDSNKDTSHNDSNNNNNNNDDDDLTQDDDMDNTYEHKPLTHDASRPPHALF
PDTDNFTGRGTGANKGGVVVTAGGGTILQAVNGGGDDPGPHPLVVDGSAWDSPRPAPPLPDETIEMESSAAYPGL
RRKGGGALWQQNRWI*
Coding >Ophcf2|02862
ATGGCCAGGTCGACGACGTGGTCGGCACCCGATCCTCCCACGACGACGCGCCCTGCCCTGAGCAAACGTCGCGAT
GCCGGAACCGTCTGCGGCTTCATAGGAGGCGACGCGGCCTTTCCGGCAACCTGCATCGCCGGATCTCACTGCGCC
GTCGACGTCGCTCACGGCGTCGTTGGCTGCTGTCCAGATGACGGCCCGTGCGCGACAGGCGTCTTCACCGGCTGC
GTCGATGCCCATAGCGGGCCGCAGTCCGTGTCAGACCCGTACGTCTTCACGTGCTCGGACGGAGGGGACGTGTGT
TATCGGAACTTGTTCGAGGGGGGATTCTACCAGTTTGGTTGCGGGGCGGGTTCGCATCTTGCTACTTCGGTGGCT
ACGTCGCCGCCTGATGGTATGGCTGGATTGGCTATTGCGAGGGTTACCTTGGCTATGACGGAGTCGGTTAGGGCT
TTTGCTACGCCTGTTGAGGTGGGAGGGTTTGTGACGCCTTCTTTTGCGACGACGACGACGATGACGACGATGACG
ACATCGACGATGGATTCGGAAACTACCAGCCTGGCCAGGGCCGCCGATAACCCGACTTCGAGATTGGCTTTCGGT
CCCGTTTCGGCCCCGCCTCGGGAGTCGTCGACGCCGCCGAGCGGAGCTGTGATCGGAGGCATCATCGGCGGTGTC
TTTGGACTGGGCCTGTTGCTGGCAGCCATCATCTTCGTCTGCTGTCGTCGTCGAAGGAGATCGATGGAAAGAGTC
GACAGCAACAAAGACACCTCCCACAACGACAGCAACAACAACAACAACAACAACGACGACGACGACCTCACCCAA
GACGATGACATGGACAACACCTACGAGCACAAGCCCCTCACCCATGACGCCTCCCGGCCTCCCCACGCCCTCTTC
CCGGACACGGACAACTTCACCGGCCGCGGCACCGGCGCCAACAAGGGCGGCGTCGTCGTCACCGCCGGCGGAGGA
ACGATATTGCAGGCTGTCAACGGCGGTGGCGATGATCCGGGACCGCATCCCCTCGTCGTCGATGGATCGGCTTGG
GATTCGCCCAGGCCGGCGCCTCCTCTTCCGGACGAGACGATTGAGATGGAGTCGTCCGCTGCGTATCCCGGGCTG
CGTAGGAAGGGCGGAGGGGCGCTGTGGCAGCAGAATCGGTGGATATGA
Transcript >Ophcf2|02862
ATGGCCAGGTCGACGACGTGGTCGGCACCCGATCCTCCCACGACGACGCGCCCTGCCCTGAGCAAACGTCGCGAT
GCCGGAACCGTCTGCGGCTTCATAGGAGGCGACGCGGCCTTTCCGGCAACCTGCATCGCCGGATCTCACTGCGCC
GTCGACGTCGCTCACGGCGTCGTTGGCTGCTGTCCAGATGACGGCCCGTGCGCGACAGGCGTCTTCACCGGCTGC
GTCGATGCCCATAGCGGGCCGCAGTCCGTGTCAGACCCGTACGTCTTCACGTGCTCGGACGGAGGGGACGTGTGT
TATCGGAACTTGTTCGAGGGGGGATTCTACCAGTTTGGTTGCGGGGCGGGTTCGCATCTTGCTACTTCGGTGGCT
ACGTCGCCGCCTGATGGTATGGCTGGATTGGCTATTGCGAGGGTTACCTTGGCTATGACGGAGTCGGTTAGGGCT
TTTGCTACGCCTGTTGAGGTGGGAGGGTTTGTGACGCCTTCTTTTGCGACGACGACGACGATGACGACGATGACG
ACATCGACGATGGATTCGGAAACTACCAGCCTGGCCAGGGCCGCCGATAACCCGACTTCGAGATTGGCTTTCGGT
CCCGTTTCGGCCCCGCCTCGGGAGTCGTCGACGCCGCCGAGCGGAGCTGTGATCGGAGGCATCATCGGCGGTGTC
TTTGGACTGGGCCTGTTGCTGGCAGCCATCATCTTCGTCTGCTGTCGTCGTCGAAGGAGATCGATGGAAAGAGTC
GACAGCAACAAAGACACCTCCCACAACGACAGCAACAACAACAACAACAACAACGACGACGACGACCTCACCCAA
GACGATGACATGGACAACACCTACGAGCACAAGCCCCTCACCCATGACGCCTCCCGGCCTCCCCACGCCCTCTTC
CCGGACACGGACAACTTCACCGGCCGCGGCACCGGCGCCAACAAGGGCGGCGTCGTCGTCACCGCCGGCGGAGGA
ACGATATTGCAGGCTGTCAACGGCGGTGGCGATGATCCGGGACCGCATCCCCTCGTCGTCGATGGATCGGCTTGG
GATTCGCCCAGGCCGGCGCCTCCTCTTCCGGACGAGACGATTGAGATGGAGTCGTCCGCTGCGTATCCCGGGCTG
CGTAGGAAGGGCGGAGGGGCGCTGTGGCAGCAGAATCGGTGGATATGA
Gene >Ophcf2|02862
ATGGCCAGGTCGACGACGTGGTCGGCACCCGATCCTCCCACGACGACGCGCCCTGCCCTGAGCAAACGTCGCGAT
GCCGGAACCGTCTGCGGCTTCATAGGAGGCGACGCGGCCTTTCCGGCAACCTGCATCGCCGGATCTCACTGCGCC
GTCGACGTCGCTCACGGCGTCGTTGGCTGCTGTCCAGATGACGGCCCGTGCGCGACAGGCGTCTTCACCGGCTGC
GTCGATGCCCATAGCGGGCCGCAGTCCGTGTCAGACCCGTACGTCTTCACGTGCTCGGACGGAGGGGACGTGTGT
TATCGGAACTTGTTCGAGGGGGGATTCTACCAGTTTGGTTGCGGGGCGGGTTCGCATCTTGCTACTTCGGTGGCT
ACGTCGCCGCCTGATGGTATGGCTGGATTGGCTATTGCGAGGGTTACCTTGGCTATGACGGAGTCGGTTAGGGCT
TTTGCTACGCCTGTTGAGGTGGGAGGGTTTGTGACGCCTTCTTTTGCGACGACGACGACGATGACGACGATGACG
ACATCGACGATGGATTCGGAAACTACCAGCCTGGCCAGGGCCGCCGATAACCCGACTTCGAGATTGGCTTTCGGT
CCCGTTTCGGCCCCGCCTCGGGAGTCGTCGACGCCGCCGAGCGGAGCTGTGATCGGAGGCATCATCGGCGGTGTC
TTTGGACTGGGCCTGTTGCTGGCAGCCATCATCTTCGTCTGCTGTCGTCGTCGAAGGAGATCGATGGAAAGAGTC
GACAGCAACAAAGACACCTCCCACAACGACAGCAACAACAACAACAACAACAACGACGACGACGACCTCACCCAA
GACGATGACATGGACAACACCTACGAGCACAAGCCCCTCACCCATGACGCCTCCCGGCCTCCCCACGCCCTCTTC
CCGGACACGGACAACTTCACCGGCCGCGGCACCGGCGCCAACAAGGGCGGCGTCGTCGTCACCGCCGGCGGAGGA
ACGATATTGCAGGCTGTCAACGGCGGTGGCGATGATCCGGGACCGCATCCCCTCGTCGTCGATGGATCGGCTTGG
GATTCGCCCAGGCCGGCGCCTCCTCTTCCGGACGAGACGATTGAGATGGAGTCGTCCGCTGCGTATCCCGGGCTG
CGTAGGAAGGGCGGAGGGGCGCTGTGGCAGCAGAATCGGTGGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail